KEGG   Parus major (Great Tit): 107205356Help
Entry
107205356         CDS       T04864                                 

Definition
(RefSeq) cytosolic phospholipase A2 epsilon-like
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
pmaj  Parus major (Great Tit)
Pathway
pmaj00564  Glycerophospholipid metabolism
pmaj00565  Ether lipid metabolism
pmaj00590  Arachidonic acid metabolism
pmaj00591  Linoleic acid metabolism
pmaj00592  alpha-Linolenic acid metabolism
pmaj01100  Metabolic pathways
pmaj04010  MAPK signaling pathway
pmaj04217  Necroptosis
pmaj04270  Vascular smooth muscle contraction
pmaj04370  VEGF signaling pathway
pmaj04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:pmaj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    107205356
   00565 Ether lipid metabolism
    107205356
   00590 Arachidonic acid metabolism
    107205356
   00591 Linoleic acid metabolism
    107205356
   00592 alpha-Linolenic acid metabolism
    107205356
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107205356
   04370 VEGF signaling pathway
    107205356
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    107205356
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    107205356
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107205356
Enzymes [BR:pmaj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     107205356
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B cPLA2_C2 C2
Motif
Other DBs
NCBI-GeneID: 107205356
NCBI-ProteinID: XP_015485161
Position
5
AA seq 835 aa AA seqDB search
MDQDGILSKFQELITQTSQQGDGTMQLNPDGKQQTSLTKVESSPCYLLTVRVIRARNIHQ
ADVLSHTDCYVSLWLPTASNDKFQTKAIKNCKDPVWNETFYFRIQSQVKNVLELALYDKD
VVTQDDHLFTVYFDIAKLSLGEEVFMHFKCDSQRREELEVGFALDNISGPPETIITNGVL
VSRKVCCLEVQVVEKKKKNKKSKKEFSFKVQGSYEGTQDIVLGSDLVFSSSFPAKFHYAR
YKQPTLDVTLPGKKLPPSSHSHVYDTSSANVELHSIPSGKNMILAEDKRFDLCAKAEDCP
DHLDVRLGFDLCIQEQDFLCKRKNYVMPALKKVLQLEQDLLDHETPVVAVMTTGGGMRSL
TALYGSLRGLKKLNVLDCATYLTGLSGTTWTMSNLYRDADWSRKDLDKQISEARKHMTKC
KINSFSLEYLKYYKKQLCQRKREGRKTSFIDLWGLVLESFLHDGKDNHRLSDQQQAIDRG
QNPLPIYTAVNVKNNYSTLDFKEWVEFTPYEVGLQKYGVFVRTEDFGSEFFMGRLMKKVP
ESRICFLEGMWSSLFSFNVLYIWNLSHSSEDFWHRWTRDQIDNIEEEPPLPVKPQELQTR
LFTPPGPLGSALRAVLADRVCIAQEHNFLKGFQMHDDYLENTHFCRWKDTVLDTFPNQLT
QSDEFLSLVDTGFFINTSIMPLLKPERKVDVILHLNYSAGSQIQALDQTCKYCSEQGIAF
PRVDLSEEDRKKLKECYLFDGAETPGAPVLLFFPLVNDTFQKYKAPGQKRSESEMEDGKV
DLYGCCSPYSTYSLQYTEKEYDLLVQLGEYNILNNEDLIVQALRTAVARKRQIKK
NT seq 2508 nt NT seq  +upstreamnt  +downstreamnt
atggaccaggatggcattttgtctaagttccaggagttgatcactcaaacctctcaacaa
ggagacggaactatgcagctgaatcctgatgggaaacagcagacttctcttacaaaggta
gaatcctctccgtgttatttactgactgtaagagtcataagagcaagaaatatccaccag
gcagatgtcttgagccatactgattgctacgtgagcctgtggctgccgactgcttcaaac
gacaaatttcagactaaagccatcaagaattgcaaagatccagtctggaatgaaactttc
tacttcaggatccagagtcaggtcaagaatgtgctggagctggcactctatgataaggat
gtggttactcaggatgaccacctcttcacggtgtactttgacatagccaaactttccctg
ggggaggaagtcttcatgcacttcaagtgtgattcacagagacgagaggagttggaggtg
ggatttgccttggataatatttcaggccctcctgaaaccatcattactaatggagtgcta
gtgtctcgcaaagtctgctgcttagaagttcaggtggttgagaagaagaagaaaaataaa
aaatcaaaaaaagaattttcctttaaagtgcaaggctcttatgaaggcacccaggacatt
gtgctgggatctgatctggttttcagctcctcctttcctgccaaattccattatgccaga
tacaagcagccaacactggatgttacactaccaggaaagaaactacctccctcctcacac
tcacatgtgtatgatacaagctctgcaaatgtggaacttcattccattccaagtggaaaa
aatatgatcttagcagaggataaaagatttgatttatgtgcaaaggcagaagactgccca
gaccaccttgatgtgcgtttaggatttgatctctgcatacaggaacaagactttctctgc
aaaaggaagaattatgttatgcctgctctgaagaaggttctgcagctggaacaggatctg
ctggaccatgagaccccggtggtggccgtcatgaccacgggaggagggatgagatccttg
acagcactctatggcagcctgagagggctcaagaagctcaatgtcttggactgtgccacc
tacctgactggcttgtctggtactacgtggaccatgtcaaacttgtacagagatgctgac
tggtcacgaaaggatctcgacaagcaaatcagtgaggctcgaaaacatatgacaaaatgc
aaaataaattccttttccttggaatatttgaagtattacaaaaagcagctgtgccaacgg
aaaagagagggccgcaaaacatcttttatagacctctgggggcttgtcctggaatctttt
ttgcatgatgggaaagacaaccacagactctcagatcagcaacaggccattgatcgtggt
cagaacccacttcctatctacactgcagtcaatgtcaagaacaactacagcactctggat
ttcaaagaatgggtggagttcaccccatatgaggtgggattgcaaaaatatggagttttt
gttcgcacggaggattttggcagtgagttcttcatgggacgattgatgaagaaggtccct
gaatccaggatctgcttcttggaaggcatgtggagtagtttattttcattcaatgtgtta
tatatctggaatttgtcccattcatcagaagatttctggcacaggtggacccgggaccaa
attgacaatatagaggaggagcccccgctgcccgtgaagccccaggagctgcagacacgg
ctgttcacaccgcctgggcccctgggcagcgccctgcgcgctgtcctcgccgaccgcgtc
tgcatcgcccaggagcacaacttcctcaagggcttccagatgcacgacgactacctggag
aatacacacttctgcaggtggaaagatactgtgttagacacatttcccaaccagctgacg
cagtcagatgaattcctgtctctggtagatactggatttttcatcaatacaagcatcatg
ccacttttaaaaccagagagaaaggtggacgtcatcctgcatttaaattacagtgcagga
tcccagatacaggctttggaccagacctgcaagtactgctctgagcagggaattgctttt
cccagggtagacttgagtgaagaagacaggaaaaagctgaaggagtgttacctctttgat
ggtgctgagactccaggagcaccagtactgctgtttttcccactagttaatgataccttc
caaaaatacaaagcaccaggtcagaagcgctcagagtcagagatggaagatggcaaagtt
gatctctatggctgctgttccccatattcgacgtattcccttcagtacactgagaaggag
tatgacctcctggttcagctgggtgaatacaacatcctcaataacgaagacctcattgta
caggccttgcgcacagcagtggcacggaaaaggcagataaagaaatga

DBGET integrated database retrieval system