KEGG   Parus major (Great Tit): 107205389Help
Entry
107205389         CDS       T04864                                 

Gene name
ABHD12B
Definition
(RefSeq) protein ABHD12B
  KO
K13704  abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
pmaj  Parus major (Great Tit)
Brite
KEGG Orthology (KO) [BR:pmaj00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:pmaj01002]
    107205389 (ABHD12B)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pmaj04147]
    107205389 (ABHD12B)
Enzymes [BR:pmaj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     107205389 (ABHD12B)
Peptidases [BR:pmaj01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   107205389 (ABHD12B)
Exosome [BR:pmaj04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   107205389 (ABHD12B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Abhydrolase_3 Thioesterase Say1_Mug180 Cutinase Lipase_3 Peptidase_S9
Motif
Other DBs
NCBI-GeneID: 107205389
NCBI-ProteinID: XP_015485197
Position
5
AA seq 358 aa AA seqDB search
MRRRGGDGDSGDSGDIGRAEGRSGAARQGRAQHSWLPGLRTLLLAPLLTYTSLPFLIRLF
PSVLTKFVYLNFLAFPFFVDFRRPEVLVTNTINLQLSTEPGVTVGVWHTVPGSRGAEARG
KDQRWYEEALADAHPVIIYLHGNGGTRAASHRVQFLKTMGAADFHILALDYRGYGDSTGH
PSESGFTTDVLALYDWAKARSGNSSILFWGHSLGTGIATNAARKLQEERGVQVDAVVLES
PYTNIRDAAANIPITKIYRQFPGFESLILDSLARAGMFFRSDENVKVLGCPLLILHAEDD
GVLPPKLGRKLYETAHKAYKDKSKVKFITFPEKLGLGHDYISFNPELPSLVRDFLNMK
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgcggcgtcgcggcggggacggcgacagcggcgacagcggcgacattgggagggcggag
ggcaggtccggcgcggcccggcagggacgggctcagcactcctggctcccagggctgcgc
accctcctcctggccccgctgctcacctacacctccttgcccttcctcatccgcctcttc
cccagcgtgctcaccaaatttgtctacctgaacttcctggccttccccttcttcgtggac
tttcggcggccggaggtgctggtgaccaacaccatcaacctgcagctcagcacagagccg
ggtgtcacagtcggtgtctggcacacggtgccgggcagcagaggggccgaggcgcggggc
aaggaccagcgctggtacgaggaggctcttgctgatgctcaccccgtgatcatctacctg
cacggcaatgggggcaccagggctgcgagtcaccgtgtccagttcttgaagacgatgggg
gctgctgactttcacatcctggctctcgactacagaggctatggggactccactggacac
ccctcagagagtggcttcaccacggatgtcctggcgctctatgactgggcgaaagcgcgg
agtgggaacagcagcatcctcttctggggacattccctggggacagggattgccaccaac
gcagcgaggaaactgcaggaggagcgaggggtccaggttgatgccgtggtgctggagtct
ccctacaccaacatccgagacgcagctgccaacatccccatcaccaagatctaccggcag
ttcccgggtttcgagtccctcatcctggactccctggctcgggcaggaatgttcttccgc
agtgatgagaatgtgaaggtgctgggctgccccctcctcatcctgcacgcagaagatgac
ggagtcctgcctccaaagctgggacgcaagctctatgagacagcacacaaagcctacaag
gacaaatccaaggtgaagttcattacctttcccgaaaagctgggcttgggccacgactac
atctccttcaacccagagctgccttccctggtgagagacttcttaaacatgaagtga

DBGET integrated database retrieval system