KEGG   Parus major (Great Tit): 107205699
Entry
107205699         CDS       T04864                                 

Gene name
AKAP5
Definition
(RefSeq) A-kinase anchor protein 5 isoform X2
  KO
K16522  A-kinase anchor protein 5
Organism
pmaj  Parus major (Great Tit)
Brite
KEGG Orthology (KO) [BR:pmaj00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pmaj01009]
    107205699 (AKAP5)
Protein phosphatases and associated proteins [BR:pmaj01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     107205699 (AKAP5)
SSDB
Other DBs
NCBI-GeneID: 107205699
NCBI-ProteinID: XP_015485894
Position
5
AA seq 596 aa
MVKAAKEIQMENPREAETPSTGATCSPPEEQAKKPSMLCFKKQKKSCKKGLTVKDACEGA
SEEKSQCVSADQEEAKASNPSRSSKGTWAAIKNLAKPRRRQKSSSRKKVPSDSQVQLEVD
AEESCARDLPKKRASSGVKMPCVRFSRGKKKPSPSEAVEESEGSVQANEMMGVVNKASEE
LEDLAPTDKSESFSPVSAQEERDMVKQDQHRMKEEKDTVKEDQDTVKEDQEMGKEDQDTV
KEDHDTAKESDTSVGKSEPLTEPTYDAEEHSECTVQLEITHSETADETAQDKLQEGSLPQ
ITNDAKGREVAPKVPVPKDQHDNVPEITEWQEIPNICKEMPERDELEKSINLPKECKAEE
SVTDFSELASGGDAASVQEAVSVQDAVSVQDAVSVKDAVSVKDAVSVQDITSMQDAMSVQ
DAVNVQETASVQEAASVQEAVSAQDVSSVQDAVSAQDVSSVQEAVSVQECSSRQILEANA
GAGVSIVITITEAEDSDNTDSDQAYEPSPVLRQKKQKGNKKSNRNADVGEKEGPEAGGGP
QAEEKGLGDQGHRTGEQYELLLVETASSLVKAAIQSSIEQLVNEMALEQNKHNSFL
NT seq 1791 nt   +upstreamnt  +downstreamnt
atggtgaaggcagctaaagaaattcaaatggagaacccaagagaggcagagactcccagc
acaggggctacatgttccccaccagaggaacaagcgaaaaaaccctctatgctctgtttt
aagaagcaaaagaaatcctgtaagaaagggctgactgtgaaggatgcgtgcgaaggagcc
tcagaagagaaaagccaatgtgtcagcgctgaccaagaggaggcaaaagcttccaatcca
tcacgatcctccaaagggacttgggcagccatcaaaaaccttgccaaacctcggagaagg
cagaagtcctcctcacggaagaaggtgccctctgattcccaagtgcagctggaggtggat
gctgaggagagctgtgcgcgagacctcccaaagaaacgggcgagctctggggtgaagatg
ccctgtgtgagattctccagaggcaagaaaaaacccagcccctcagaagcagtggaggag
tcagagggcagtgttcaagcaaatgaaatgatgggtgttgtgaataaggctagtgaagag
ctagaggatttggccccgacggacaaatctgaatccttcagcccagtctctgcacaggag
gagcgggatatggtgaaacaggatcagcatagaatgaaagaggagaaggacacggtgaaa
gaggatcaggatacagtgaaggaggaccaggaaatggggaaggaggaccaggatacagtg
aaagaggaccacgatacagcaaaggaaagtgacacctctgttgggaagagtgagcccttg
acagagcccacatatgatgcagaggaacattcggagtgcactgttcagttggagataacc
cattcagagacagctgatgaaacagcccaggacaaactgcaggaagggagcctaccccaa
atcaccaatgatgcaaaggggagggaagttgctcccaaagtgcctgttcctaaagaccaa
catgacaatgtccctgaaatcacagagtggcaggaaatccctaatatctgcaaagagatg
cctgaaagggatgaactggaaaagagcataaatcttcccaaggagtgcaaagccgaggag
tctgtaactgatttcagtgagttggcatcaggaggtgatgcagcaagtgtgcaggaggca
gtgagtgtgcaggatgcagtgagtgtacaggatgcagtgagtgtgaaggatgcagtgagt
gtgaaggatgcagtgagtgtgcaggatatcacaagtatgcaagatgccatgagtgtacag
gatgcagtgaatgtgcaagagacagcgagtgtgcaggaggcagcaagtgtgcaggaggca
gtgagtgcacaggatgtatcaagtgtgcaggatgcagtgagtgcacaggatgtatcaagt
gtgcaggaggcagtgagtgtgcaggaatgctccagccgtcaaatattagaagcaaatgca
ggtgctggtgtcagcatcgtcatcaccatcaccgaagctgaggactccgacaacaccgac
tctgaccaggcctatgagccgtccccagttttgcgtcaaaaaaagcaaaaagggaataaa
aaatcgaacaggaatgctgatgttggtgaaaaagagggccccgaggctggtggcggtccc
caggcagaggagaaaggtctgggtgaccaggggcacagaactggggagcagtacgagttg
ctccttgtagaaaccgcctcttccctcgtgaaggcggccattcagtcatccatagagcag
ctggtcaacgaaatggccctggaacagaataaacacaacagctttctgtga

DBGET integrated database retrieval system