KEGG   Parus major (Great Tit): 107205967Help
Entry
107205967         CDS       T04864                                 

Gene name
GALC
Definition
(RefSeq) galactocerebrosidase isoform X1
  KO
K01202  galactosylceramidase [EC:3.2.1.46]
Organism
pmaj  Parus major (Great Tit)
Pathway
pmaj00600  Sphingolipid metabolism
pmaj01100  Metabolic pathways
pmaj04142  Lysosome
Brite
KEGG Orthology (KO) [BR:pmaj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    107205967 (GALC)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    107205967 (GALC)
Enzymes [BR:pmaj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.46  galactosylceramidase
     107205967 (GALC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_59 Glyco_hydro_59M Glyco_hydro_30
Motif
Other DBs
NCBI-GeneID: 107205967
NCBI-ProteinID: XP_015486627
Position
5
AA seq 765 aa AA seqDB search
MATRASPACPALFQNGSLSSAGGAARRGWEGFLPSSPWSSMVVPGAAAPPRCGHVPRVAG
HCGGAAGTGRPRGAVRAELHLDRSCTGTGTGMSCAALLWGTILLACSCGPGPPRVGAAPL
LAATYVLDDANGLGREFDGIGAVSGGGATSRLLVNYQEPYRSQILDYLFKPNFGASLHIL
KVEIGGDAQSTDGTEPSHMHYENDENYFRGYEWWLMKEAKKRNPQIKLIGLPWAFPGWIG
KGENWPYDYPDITAYYIVSWILGAKQYHDLDIDYIGIWNERAFNSKYIKLLRYTLDKHGL
EQVRIIASDRLWEPISFVMMIDSELHGVVDVIGAHYPGTKTVQNAILTGKKLWSSEDYST
FNDDVGAGCWARILNQNYVNGNMTSTIAWNLVASYYEELPFGRCGLMTAQEPWSGHYKVE
SPIWITAHTTQFTQPGWSYLQVDGHLEGGGSFVALTDGLGNLTIIIETMSHNHSKCIRPP
LPNFNVIPQRATFYLRGSFYMVETLQVWHSRLDFESGHSSLFQKLRPVKVWKGRFTLDLN
VDEVYTLTTLKTGRKYSCPEPPPPQPFPSNYKDDFNIRNPPFSEAPNFADQTGVFEYFVN
ASDPGDHVFTLRQVVVQRPITWVSDADQTISVIGNFKWVNMTVTCDIYIEKPRDGGVFIA
GRVDNGGIYVRRTKGVFFWVFADGTYRVTGDLAGEEILMKGLAGVRDNAWHTLTLNIQGN
SASGLLNGYPLWENVTISKPQNGWAALGTRSFELAQFDNFQVEAC
NT seq 2298 nt NT seq  +upstreamnt  +downstreamnt
atggcgacacgcgcctcaccagcttgccctgccctttttcaaaatgggagcttgagttca
gcgggcggggctgcccgtagaggctgggaaggcttcctgccctcctctccctggagcagc
atggtggtgccgggcgctgccgccccgccccggtgcggtcatgtgccgcgcgttgccggg
cactgcggaggcgctgcagggacggggcggccgcggggcgcagtgagagcggagctgcac
ctggaccggagctgcaccggcaccgggaccgggatgagctgcgcggctctgctctggggc
acgattctgcttgcctgcagctgcggcccggggccccccagggtcggtgctgctccgctc
ctggcggctacctacgtgctggacgatgccaacgggctgggcagggagttcgacgggatc
ggggctgtcagcggcggcggggccacatctagactcctggtgaactaccaagaaccgtat
cgctcccagattttagattacctgttcaagccaaattttggtgcttctttacatattctc
aaggtagagattggaggtgatgcccagtcaacagacggtactgaaccctcccatatgcac
tatgaaaatgatgagaactacttccggggctatgaatggtggctgatgaaagaagctaaa
aagagaaacccccaaattaaactgattggattaccttgggcatttccaggatggataggg
aagggggaaaattggccctatgactatccagatatcactgcttactatattgtttcttgg
atattaggagcaaaacagtatcatgatttggacattgattatattgggatatggaatgaa
agggcatttaatagcaaatacattaagctgttgaggtacacattggataagcatggtctg
gagcaggtgaggatcatagccagcgatagactgtgggagcccatttcctttgtcatgatg
attgactctgagctccacggagtggtcgatgtgattggggctcactatcctgggacaaaa
acagtgcaaaatgctatattaactgggaagaaactgtggtcgtcagaagattacagtact
ttcaatgatgatgttggtgcaggatgctgggctcggatcctgaaccaaaactacgtgaat
ggaaacatgacctcaacaatcgcatggaatttggtggccagttattatgaggagttgccc
tttggtcgatgtggattaatgacagcacaggagccatggagtggccactataaagttgaa
tctcctatctggattacagcacacaccacacaatttactcaaccaggctggtcatacttg
caagtggatggacacttagaaggaggtggcagctttgtagctctgacagatggcctaggg
aaccttaccatcataattgaaactatgagtcataatcactctaaatgtatcaggcctcca
ttgccaaatttcaacgtcatacctcagagagcaactttctacctcagagggtcattttat
atggtggaaacccttcaagtgtggcactctagacttgattttgaatctggacactccagt
cttttccagaaactccgtcctgtaaaggtatggaagggaagatttactttagatctaaat
gtggatgaagtctacactttaaccacactcaagacaggacggaaatacagttgcccagag
ccgcctcctcctcagccctttccttcaaattacaaagatgatttcaatatacgtaatcca
cctttcagtgaagccccaaattttgcagatcagacaggtgtatttgaatactttgtaaat
gcttctgaccctggagatcatgtgttcacactccgccaggtggtggttcagcggcccatc
acttgggtttctgatgcagaccagaccatcagtgtcataggaaattttaagtgggtaaat
atgacagtcacttgtgacatctacatagaaaaacctcgtgatggaggcgtgtttattgca
ggaagagttgacaatggtgggatatatgtgcgacgtaccaaaggagttttcttctgggtt
tttgcagatggcacctacagagtcactggtgacctagctggagaggaaatattaatgaaa
ggacttgctggtgtccgggataatgcatggcacacactcactctcaacattcagggcaac
tccgcctcaggactgttaaatggttatccactctgggagaatgtcaccatttctaaacca
cagaacggctgggctgctctcggaactcgctcgtttgagttggcacagtttgacaacttc
caggttgaagcttgctga

DBGET integrated database retrieval system