KEGG   Parus major (Great Tit): 107206798Help
Entry
107206798         CDS       T04864                                 

Gene name
BMPR1A
Definition
(RefSeq) bone morphogenetic protein receptor type-1A
  KO
K04673  bone morphogenetic protein receptor type-1A [EC:2.7.11.30]
Organism
pmaj  Parus major (Great Tit)
Pathway
pmaj04060  Cytokine-cytokine receptor interaction
pmaj04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:pmaj00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    107206798 (BMPR1A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107206798 (BMPR1A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pmaj01001]
    107206798 (BMPR1A)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:pmaj04090]
    107206798 (BMPR1A)
Enzymes [BR:pmaj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     107206798 (BMPR1A)
Protein kinases [BR:pmaj01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   107206798 (BMPR1A)
CD molecules [BR:pmaj04090]
 Proteins
  107206798 (BMPR1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase TGF_beta_GS Activin_recp Pkinase_fungal FTA2 Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 107206798
NCBI-ProteinID: XP_015488501
Position
6
AA seq 533 aa AA seqDB search
MTRLRVHEQLLGAYLLIILHVQGQKLDSMLHGTGMKTNSEQKKQANGVTLAPEDTLPFLK
CYCSGHCPDDAINNTCITNGHCFAIIEEDEHGEPTLASGCMKYEGSDFQCKDSPKAQLRR
TIECCRTDFCNQDLQPTLPPLDSTDGLFDGSIRWMAVLISMAVCIIVMVILLSCFCYKHY
YKSMAKRHCYNRDLEQDEAFIPAGESLKDLIDQSQSSGSGSGLPLLVQRTIAKQIQMVRQ
VGKGRYGEVWMGKWRGEKVAVKVFFTTEEASWFRETEIYQTVLMRHENILGFIAADIKGT
GSWTQLYLITDYHENGSLYDFLKCTTLDNRALLKLAYSAACGLCHLHTEIYGTQGKPAIA
HRDLKSKNILIKKNGTCCIADLGLAVKFNSDTNEVDVPLNTRVGTKRYMAPEVLDESLNK
NHFQPYIMADIYSFGLIIWEMARRCVTGGIVEEYQLPYYDMVPNDPSYEDMREVVCVKRL
RPVVSNRWNSDECLRAILKLMSECWAHNPASRLTALRIKKTLAKMVESQDVKI
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgactcgattgagagttcatgagcaattgcttggagcctatctgcttatcattcttcat
gttcaaggtcaaaagctggacagcatgcttcatggtacaggaatgaagacaaattctgag
caaaagaaacaagcaaatggagtaacacttgctccagaggacaccttaccttttcttaaa
tgctactgctcaggacattgtccagatgatgctattaacaacacatgcataactaatggg
cattgctttgctatcattgaggaggatgaacatggagaacccacacttgcttctggctgc
atgaagtatgaaggttcagacttccagtgcaaggactcacctaaagcgcagttacgtcga
acaattgaatgctgtcgtactgatttctgcaatcaggatttgcagccaacattaccacct
cttgatagtacagatggactttttgatggcagcattcgttggatggcagtgttgatttct
atggcagtctgcataattgtcatggtcatcttacttagctgcttttgttacaagcattac
tataagtcgatggcaaagaggcactgttataatcgtgacctggaacaagatgaagcattt
attccagctggggagtcattaaaagaccttattgaccagtcacagagttctgggagtgga
tcaggactaccactgttggttcagcgcactattgccaaacaaattcagatggtgaggcag
gttggaaaagggcgatatggtgaagtgtggatgggcaaatggaggggtgaaaaagtggca
gtgaaagtgttttttaccacagaagaagccagctggttccgagaaacagagatttaccaa
actgttctcatgcgacatgaaaacatcctcggtttcatagcagcagatattaaaggcact
ggctcctggacacagctttacttgatcacagattatcatgaaaacggatcattgtatgat
tttctgaagtgcactacgctggacaacagggctctgctcaaactggcctattctgctgcg
tgtggcctgtgccacctgcacacggaaatctatgggacacaaggcaagcctgcgattgca
cacagggacctgaagagtaaaaacatcttgataaagaaaaatggaacctgctgcattgca
gacttgggtcttgcagtcaagtttaacagtgacacaaatgaagttgacgttcccttgaac
actagagtgggaacaaaacgttacatggctccagaagtcctggatgaaagcctgaataaa
aaccatttccagccgtacatcatggctgacatctacagttttgggctgatcatctgggag
atggctcggcgctgtgtcacaggaggtattgttgaagagtatcagttgccatattatgac
atggtgccaaatgatccatcctatgaggacatgagagaagtggtgtgtgtcaaacgcctg
cgcccagtggtatcaaacagatggaacagtgatgaatgtttaagagcaatattgaagttg
atgtctgagtgctgggctcataatcctgcctcaaggctcactgccttgaggatcaagaag
acacttgccaagatggtggaatcacaagatgtaaagatttga

DBGET integrated database retrieval system