KEGG   Parus major (Great Tit): 107206815Help
Entry
107206815         CDS       T04864                                 

Gene name
CAMK2G
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II subunit gamma isoform X1
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
pmaj  Parus major (Great Tit)
Pathway
pmaj04012  ErbB signaling pathway
pmaj04020  Calcium signaling pathway
pmaj04114  Oocyte meiosis
pmaj04217  Necroptosis
pmaj04261  Adrenergic signaling in cardiomyocytes
pmaj04310  Wnt signaling pathway
pmaj04912  GnRH signaling pathway
pmaj04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:pmaj00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107206815 (CAMK2G)
   04310 Wnt signaling pathway
    107206815 (CAMK2G)
   04020 Calcium signaling pathway
    107206815 (CAMK2G)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107206815 (CAMK2G)
   04217 Necroptosis
    107206815 (CAMK2G)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    107206815 (CAMK2G)
   04916 Melanogenesis
    107206815 (CAMK2G)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107206815 (CAMK2G)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pmaj01001]
    107206815 (CAMK2G)
Enzymes [BR:pmaj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     107206815 (CAMK2G)
Protein kinases [BR:pmaj01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   107206815 (CAMK2G)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase CaMKII_AD Pkinase_Tyr SnoaL_3 DUF4440 Kdo SnoaL_2 RIO1
Motif
Other DBs
NCBI-GeneID: 107206815
NCBI-ProteinID: XP_015488560
Position
6
AA seq 608 aa AA seqDB search
MATTATCTRFTDEYQLYEELGKGAFSVVRRCVKKNSSQEYAAKIINTKKLSARDHQKLER
EARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIHQI
LESVNHIHQHDIVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGEQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDT
VTPEAKNLINQMLTINPAKRITADQALKHPWVCQRSTVASMMHRQETVECLRKFNARRKL
KGAILTTMLVSRNFSAAKSLLNKKSDGVKKRKSSSSVHLMPQSNNKTSIVSTAKETPPVQ
TSMEPQTTVVHNATDGIKGSTESCNTTTEDEDLKAPPLSTGDGSSVLEGRRHSESKTQTE
SMQSQLSLCFSATTQSCEEKLHAWDSPGQTLELERARSEPLLTPVVPFVLNRAPLRKQEI
IKITEQLIEAINNGDFEAYTKICDPGLTSFEPEALGNLVEGMDFHKFYFENLLSKNSKPI
HTTILNPHVHVIGEDAACIAYIRLTQYIDGQGRPRTTQSEETRVWHRRDGKWLNVHYHCS
GAPAAPLQ
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atggccaccacggcaacgtgcacccgcttcaccgacgagtaccagctctacgaggagctt
ggcaagggagccttctctgtggtccgcagatgtgtaaagaaaaattcttcacaagaatat
gctgcaaaaatcatcaacaccaaaaaactgtcagccagagatcaccagaaactggaacgt
gaagctcgaatttgccgacttctaaagcatccaaatattgtgcgactccatgacagtatt
tcagaagaaggtttccattacctcgtctttgatctggttactggtggggagctctttgag
gatattgttgctagagaatactacagtgaagcagatgccagccactgtattcatcagata
ctggagagtgtgaatcacattcaccagcatgatattgttcacagggacttgaagcctgag
aatttactactagcgagtaaatgtaagggcgctgctgtcaaactggctgacttcggactg
gctatagaagtccagggagagcagcaggcctggtttgggtttgctggtactccaggctac
ctctcccctgaagtcttaagaaaagatccttatggaaaaccagtggatatatgggcatgt
ggagtgattctgtacatattactagtggggtaccctcccttttgggatgaagatcagcac
aaactctatcagcagatcaaagccggagcctatgacttcccatcacctgagtgggacact
gtgactcctgaagccaagaatttgatcaaccagatgctgacgataaacccagcaaagcgt
atcacagctgaccaggctctcaaacacccatgggtttgtcaacgatccactgttgcatca
atgatgcacaggcaggagaccgtggaatgcttgagaaagttcaatgctagaaggaagcta
aagggtgcaatccttacgacaatgcttgtgtctcggaatttttcagctgccaaaagcctg
ctgaataagaagtcagatggagtgaagaaaaggaagtcgagctccagtgtgcatttgatg
ccacagagcaacaacaaaaccagtatagtaagcactgcaaaagaaacacccccagtgcag
acgtccatggagcctcaaacaactgttgtccataatgctacagatggcataaagggttcc
acagagagctgtaacaccacaactgaagatgaggatctgaaagctccccctctctccacc
ggggacggcagctcagtgcttgaaggacggaggcacagtgagagcaaaacacagactgag
tccatgcagtcccagctttctctctgtttctcagccactacacagtcttgtgaagagaag
ctccatgcctgggacagcccagggcagacattggagttagaacgtgctcggtcggagcct
ttgctaactccagtagttccctttgtacttaaccgagcaccgttgcgtaagcaagagatc
attaagataacagagcagctgatagaagccatcaacaatggagattttgaggcttataca
aaaatctgtgatcctggcttgacctcatttgaacctgaagcactggggaacctggttgaa
ggaatggatttccataagttttactttgaaaacttactgtcgaagaacagcaaaccaatc
cacacgaccatcctgaacccccacgtccacgtcatcggggaggacgccgcctgcatcgcg
tacatccgcctgacgcagtacatcgacggccaaggccggccccgcaccacgcagtcagag
gagacccgtgtctggcaccgccgggatggcaagtggctcaatgtccactaccactgctct
ggagctcctgcagcacctctccagtga

DBGET integrated database retrieval system