KEGG   Parus major (Great Tit): 107207068Help
Entry
107207068         CDS       T04864                                 

Gene name
MINPP1
Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
pmaj  Parus major (Great Tit)
Pathway
pmaj00010  Glycolysis / Gluconeogenesis
pmaj00562  Inositol phosphate metabolism
pmaj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmaj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107207068 (MINPP1)
   00562 Inositol phosphate metabolism
    107207068 (MINPP1)
Enzymes [BR:pmaj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     107207068 (MINPP1)
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     107207068 (MINPP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 His_Phos_1 DUF4708
Motif
Other DBs
NCBI-GeneID: 107207068
NCBI-ProteinID: XP_015489233
Position
6
AA seq 453 aa AA seqDB search
MAPRREAGLLLLLLVLPPASAGLSGFFGTKSRYEEVNPHLVSDPLSLGPGAGGSLPASCT
PLQLRAVLRHGTRYPTAGQIRRLGELHARLLRRAPGAAACPAAAALADWPMWYEESLDGR
LAPQGRRDMEQLARRMAARFPALFAARRRLALASSSKHRCLQSGAAFRRGLGPTLDFGGD
EVEVEVNDSLMRFFDHCAKFVALVEENDTAMCQVNAFKEGPEMKKVLEKVASALCLPVEE
LNADLVQVAFLTCSYELAIKNVTSPWCSLFSEEDAKVLEYLNDLKQYWKRGYGYDINSRS
SCILFQDIFQHLDKAVEESKSSKPISSPLIVQVGHAETLQPLLALMGYFKDDEPLLASNY
ARQAHRKFRSGRIVPYAANLVFVLYHCDHVNTSQEEYQVQLLLNEKLLSFQYSNETISTY
TDLKDYYKDILENCHFKEECELPTVNVTAVDEL
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atggcgcctcgccgggaagccggcctgctgctgctgctcctcgtcctgccgccggcgagc
gcggggctgagcggcttcttcggtaccaagtcccgctacgaggaggtgaacccgcacctg
gtgagcgacccgctgtcgctgggtcccggggcgggcgggtcgctgcccgcctcctgcact
ccgctgcagctccgcgccgtgctccggcacggtacccgctaccccacggccgggcagatc
cgccggctgggcgagctgcacgcccggctgctccgccgggccccgggagccgccgcctgc
cccgccgccgccgctctggccgactggcccatgtggtacgaggagagcctggacgggcgg
ctggcgccgcagggccggcgagacatggagcagctggcccggcgcatggccgcccgcttc
cccgcgctcttcgccgcccgccgccgcctggcgctggccagcagctccaaacaccgctgc
ctgcagagcggggcggccttccgccgcggcctcgggcccaccctcgacttcggcggcgac
gaggtggaggttgaagttaacgactccctgatgcggttctttgatcactgtgccaagttt
gtagccctggtggaggagaatgacacggccatgtgccaggtgaatgccttcaaagagggg
cctgagatgaagaaggtcctggagaaggtggccagtgccttgtgtttgccggtggaggag
ctgaatgcagatcttgttcaagtggctttcctcacctgctcatatgagctagccataaaa
aatgtgacctccccgtggtgttctctcttcagtgaagaagatgctaaggtgctggaatac
ctgaatgacctgaaacaatactggaaaagaggatatggctatgacatcaacagtcgttcc
agctgcattttattccaagatatcttccagcacttggacaaagcagtggaagagagcaaa
agctccaaacccatttcttcacctttgattgtccaagttgggcatgcagagaccctccag
cccctgcttgccctgatgggttacttcaaagatgatgagcctctcctggccagcaactac
gcccggcaagcgcatcggaaattccgcagcggccgcatcgtgccttacgcagccaacctg
gtgtttgtgctctaccactgcgaccacgtgaacacctcccaggaggagtaccaggtgcag
ctgctgctcaatgagaaactgctgtccttccagtactccaacgagaccatctccacctac
acagacctcaaggactactacaaggacatcctggaaaactgccacttcaaagaggagtgc
gaattgcccacggtcaacgtcactgctgtcgatgagctgtga

DBGET integrated database retrieval system