KEGG   Parus major (Great Tit): 107207553Help
Entry
107207553         CDS       T04864                                 

Definition
(RefSeq) TGF-beta receptor type-2-like
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
pmaj  Parus major (Great Tit)
Pathway
pmaj04010  MAPK signaling pathway
pmaj04060  Cytokine-cytokine receptor interaction
pmaj04068  FoxO signaling pathway
pmaj04144  Endocytosis
pmaj04218  Cellular senescence
pmaj04350  TGF-beta signaling pathway
pmaj04520  Adherens junction
pmaj04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:pmaj00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107207553
   04350 TGF-beta signaling pathway
    107207553
   04068 FoxO signaling pathway
    107207553
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107207553
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107207553
  09143 Cell growth and death
   04218 Cellular senescence
    107207553
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    107207553
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    107207553
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pmaj01001]
    107207553
Enzymes [BR:pmaj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     107207553
Protein kinases [BR:pmaj01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   107207553
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ecTbetaR2 Pkinase Pkinase_Tyr Pkinase_fungal FixQ
Motif
Other DBs
NCBI-GeneID: 107207553
NCBI-ProteinID: XP_015490356
Position
7
AA seq 565 aa AA seqDB search
MGSWRRPGLLALLLLSLSCGASARRSLKTNLCKWCDSTAPACEEKVCYSNCNLNSYCEDP
YEICVAIWRQDNESIRISTLCHNPHRPIENLMVPNYNTSRCIMSHQPSEDGVIYVCGCVD
EQECNDKLIFENHTNGYSMLQSKEVIPVAAISLLPPLLVAVMITVIFYLCRTQKRRKRAK
VWGGKQGQPPALPEPGKATEREEKLSVLMDEGSAGTSPGCASSRPAELLPIELDEMVGKG
QFAEVWRAKLSHSRSGQYETVAVKIFPCEEYSSWKNESQIFTDTSLRHDSVLQFLTAEDR
GTGPRREYWLITAYHSRGNLKDYLSRHVLSWMELQKMAGSLVSGVAHLHSDYTACGRPKI
PIAHRDIKSTNVLVKNEQECVLCDFGIAIRLDPSLTVDDFANSGQVGTARYMAPEVLESR
VNLEDLESFKQMDVYSMALVLWEMASRCEVVGEVKNYELPFGSKVQEQPCVDTMRDIVLH
GRGRPEIPSSWLVHQGMRFLCDTITECWDHDPEARLTAHCVAERFNLMAQMDCDDILNNN
MDNEASKTASPGGEHQDSDGSRNIQ
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atggggtcctggaggagaccgggtctgcttgccttgctgctgctctccttgtcctgcggt
gccagtgcccgccgcagcctcaagaccaacctgtgcaagtggtgtgactccacagctcca
gcctgcgaggagaaggtgtgctacagcaactgcaacctcaactcctactgcgaggacccc
tacgagatctgcgtggcaatatggagacaggacaacgagagcatcaggatcagcacgctg
tgccacaacccccaccgccccatcgaaaacctcatggtccccaactacaacacctcgcgc
tgcatcatgagccaccagcccagcgaggacggggtcatctacgtctgtggctgtgtggat
gagcaggagtgcaacgacaaactcatctttgaaaaccacaccaatggctactccatgctg
cagagcaaagaggtgatccccgtggctgccatcagcctcctgcccccgctgctggtggcg
gtgatgatcacggtgatattttacctttgccgcacgcagaagcgacgcaagagagccaag
gtgtggggtgggaaacagggccagcccccggcgctgccggagccggggaaggcgaccgag
cgggaggagaagttgtccgtgctgatggatgagggctcagccggcaccagccccggctgc
gccagcagccgccccgctgagctgctccccatcgagctggacgagatggtgggcaaaggg
cagttcgcggaggtgtggagggccaagctgagccacagccgctcggggcagtacgagacc
gtggccgtgaagatcttcccctgcgaggaatactcctcctggaagaacgagagccagatc
ttcaccgacaccagcctcaggcacgacagcgtcctgcagttcctcactgccgaggaccgg
ggcacggggccccgccgggagtactggctcatcaccgcctaccacagccggggcaacctc
aaggactacctctcccgccacgtgctgagctggatggagctgcagaagatggctgggtcc
ctggtgagcggggtggcccatcttcacagcgactacactgcctgcggccgcccgaaaatc
cccatcgcccaccgcgacatcaagagcacaaacgtactggtgaagaacgagcaggagtgt
gtgctctgcgacttcggcatcgccatacgcctcgacccctccctgacagtagatgacttt
gccaacagcgggcaggtgggcaccgccaggtacatggccccagaggtcctggagtccaga
gtgaacctggaagacctggaatctttcaagcagatggatgtctactctatggccctcgtt
ttgtgggaaatggcctccagatgtgaagtggtaggagaggtaaagaattatgagctgcct
tttgggtcaaaagtccaggagcagccttgtgtggacaccatgagggacatcgtgctgcat
ggcagaggccggcccgagatcccaagcagctggctggtgcaccagggaatgcgtttcctg
tgcgacaccatcacggagtgctgggaccacgaccctgaggctcggctcactgcccactgc
gtggctgagcgcttcaacctgatggcacagatggattgcgatgacatcctcaacaacaac
atggacaatgaggccagcaaaacagcttctccaggtggggagcaccaggacagtgatggg
agcagaaacattcagtga

DBGET integrated database retrieval system