KEGG   Parus major (Great Tit): 107207820Help
Entry
107207820         CDS       T04864                                 

Gene name
FKBP7
Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase FKBP7
  KO
K09573  FK506-binding protein 7 [EC:5.2.1.8]
Organism
pmaj  Parus major (Great Tit)
Brite
KEGG Orthology (KO) [BR:pmaj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:pmaj03110]
    107207820 (FKBP7)
Enzymes [BR:pmaj01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     107207820 (FKBP7)
Chaperones and folding catalysts [BR:pmaj03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    107207820 (FKBP7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FKBP_C EF-hand_6 EF-hand_7 EF-hand_1 EF-hand_5
Motif
Other DBs
NCBI-GeneID: 107207820
NCBI-ProteinID: XP_015491031
Position
7
AA seq 334 aa AA seqDB search
MALPSRPRRCLPRAEAEPLSSGAAAAAAPAAPPAPRGALHPPCAPGRAPGPAAPRLLPTS
LPLPERRGRPEEPPAPRPLPGPGSSARPARLRRGGGAGSAPGAPGTVPRRRPPGSDMGRG
LPLLLLALALLAAPARAEGGTAAEEEVQIEVLHLPEACSPKSKKGDLLNAHYDGFLASDG
SKFYCSRTQNEGHPKWFVLGVGQVIKGLDIAMMNMCPGEKRKVTIPPSLAYGQQGYAQGK
IPPNATLVFEIELYAVNKGPRSVEAFNQIDKDGDKKLSELEISQYLKEEFARDGKKRHPS
AHDEILADIFKKNDHDGDGFISAKEYNVYQHDEL
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atggcgctcccctcccggccccgccgctgcctcccccgcgcggaggcggagccgctcagc
tcaggcgcggcggccgcggcggctccggcggcgccgcccgccccgcggggcgctctgcat
cccccatgcgcgcccggccgtgctcccggccccgccgccccgcggctgcttccgacgtcc
cttccacttcctgagcggagagggcggcccgaagaaccgcccgccccgcggccgctgcct
gggccgggctcgtccgcacgtccggcgcgactgaggcggggcggcggcgctggctcggcc
cccggcgctccggggacagtgccacgccggcggccgcctgggagcgacatgggccgcggg
ctgcccctgctcctgctggcgctggcgctgctggcggccccggcgcgggccgagggcggc
acggcggcggaggaggaggttcagatcgaggtgctgcacctccccgaggcctgcagcccg
aagagcaagaagggcgacctgctgaacgcgcactatgacgggttcctggccagcgacgga
tccaagttttactgcagtcggacgcaaaatgaaggccatccaaaatggtttgttctgggt
gttggacaagtcataaaaggcttagatattgctatgatgaatatgtgtcctggagaaaaa
cggaaagtgacaattcctccatcattagcatacggacagcaaggatacgcacagggcaag
attccacccaatgcaacattggtctttgagattgaactttatgcagtaaataagggacct
cgtagtgttgaagcatttaatcaaatagacaaggacggtgacaagaaactctctgaactt
gagataagccagtatttaaaagaagaatttgcaagagatggcaaaaaacgtcatccctct
gcccatgatgaaatcttagctgatatatttaagaagaatgaccatgatggagatggcttc
atatcagcaaaggagtacaatgtctaccagcacgacgaactctaa

DBGET integrated database retrieval system