KEGG   Parus major (Great Tit): 107207933Help
Entry
107207933         CDS       T04864                                 

Gene name
NMNAT2
Definition
(RefSeq) nicotinamide/nicotinic acid mononucleotide adenylyltransferase 2
  KO
K06210  nicotinamide mononucleotide adenylyltransferase [EC:2.7.7.1 2.7.7.18]
Organism
pmaj  Parus major (Great Tit)
Pathway
pmaj00760  Nicotinate and nicotinamide metabolism
pmaj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmaj00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    107207933 (NMNAT2)
Enzymes [BR:pmaj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     107207933 (NMNAT2)
    2.7.7.18  nicotinate-nucleotide adenylyltransferase
     107207933 (NMNAT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CTP_transf_like
Motif
Other DBs
NCBI-GeneID: 107207933
NCBI-ProteinID: XP_015491203
Position
8
AA seq 308 aa AA seqDB search
MTETTKTHVILLACGSFNPITKGHIQMFERARDYLHKTGRFIVIGGIVSPVHDSYGKTGL
VSSRHRLTMCQLAVQSSDWIRVDPWECYQDTWQTTCSVLEHHRDLMKRVTGCILSNVNTP
SITPVIGQPQNESSQSIYQNNNNISSKPTAAKILGKVGESLSRICCVRPPMESFTFVDEN
ANLGTVMRYEEIELRILLLCGSDLLESFCIPGLWNEADMEVIVGEFGIVVVPRDGADPEQ
IMNHSSILRKYKNNILVVKDDSNHPMSVVSSTKSRLALQHGDGHVVDYLCQPVIDYILKS
QLYINASG
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagaccaccaagacccacgttatcctgctggcctgcggcagcttcaaccccatc
accaaggggcacatccagatgttcgaacgagcccgggattacctgcataagactggacgc
ttcattgtcattggtggcatcgtctcacctgtgcacgactcctatgggaaaacggggcta
gtttctagccggcaccgcttgaccatgtgccagctggctgtgcagtcctccgactggatc
agggttgatccctgggagtgctaccaggacacctggcagaccacctgcagtgtgttggag
caccaccgtgacctgatgaagagagtgactggctgcatcctctccaatgtcaacacaccc
tccatcacccctgtgattggccagccccagaatgagtcctcacaaagcatctaccagaac
aacaacaacatctccagcaagcccaccgcagcaaaaatcttggggaaagtgggagaaagc
ctgagccggatttgctgtgttcgcccacccatggagagcttcacctttgtggatgaaaat
gccaacttggggacagtgatgagatatgaagaaattgagcttcgtatcttgctgctttgt
ggcagcgacctgctggagtccttctgcatccctggcctctggaatgaggcagatatggag
gtgattgttggggagtttgggatcgtggtggtgccccgggatggagcagaccctgagcaa
atcatgaaccactcctccatactgcgcaagtacaaaaacaacatcctggtggtgaaggac
gactcaaaccaccccatgtcagttgtcagctccaccaaaagcagactggccctgcagcac
ggggatggacatgtcgtggattacctctgccagcctgtcattgactacatcctcaagagc
cagctctacatcaatgcctctggctaa

DBGET integrated database retrieval system