KEGG   Parus major (Great Tit): 107208390Help
Entry
107208390         CDS       T04864                                 

Gene name
GPX7
Definition
(RefSeq) glutathione peroxidase 7
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
pmaj  Parus major (Great Tit)
Pathway
pmaj00480  Glutathione metabolism
pmaj00590  Arachidonic acid metabolism
pmaj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmaj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    107208390 (GPX7)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    107208390 (GPX7)
Enzymes [BR:pmaj01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     107208390 (GPX7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-GeneID: 107208390
NCBI-ProteinID: XP_015492245
Position
8
AA seq 210 aa AA seqDB search
MLDPEGSVEHQPASSFPKVLLIPLAMLLAIATLLLLAFSATRQKEPDFYTFKVVNIRGKL
VSLEKYRGSVSLVVNVASECGYTDSHYKALQQLQRDLGPYHFNVLAFPCNQFGQQEPDTN
KEIESFARKTYGASFPMFSKITVSGAGAIPAFKYLIDSTGEEPTWNFWKYLVDPNGKVVK
AWDSTVSVEEIRPHVTELVRKIILKKKDEL
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgctggacccggagggcagtgtggagcaccagcctgcctcctccttccccaaagtcctc
ctcatccctctagccatgctcctcgcaattgcaacgctcctgctcttagctttttccgct
acgcggcagaaggagcctgatttttacactttcaaagttgtaaacatcaggggcaagctt
gtgtctctggagaagtacaggggctcggtgtctctagttgtcaatgttgcaagtgagtgt
gggtacacagacagccactacaaggccttacagcagctgcagagagacctgggcccatac
catttcaatgtgctggcattcccctgcaatcagtttgggcagcaagaaccagacaccaac
aaagaaattgagagttttgcacgaaagacttatggtgcctccttccccatgttcagcaaa
atcacagtcagtggagctggagcaattcctgccttcaagtacttaattgattctacagga
gaagaaccaacctggaacttctggaaatacctggtggaccccaatgggaaagtagtaaag
gcctgggactctactgtctctgttgaagaaataagaccccatgttacagaacttgtaagg
aaaatcatcctaaagaagaaagatgaattatga

DBGET integrated database retrieval system