KEGG   Parus major (Great Tit): 107208967Help
Entry
107208967         CDS       T04864                                 

Gene name
TIPARP
Definition
(RefSeq) TCDD-inducible poly [ADP-ribose] polymerase
  KO
K15259  poly [ADP-ribose] polymerase 7/11/12/13 [EC:2.4.2.30]
Organism
pmaj  Parus major (Great Tit)
Brite
KEGG Orthology (KO) [BR:pmaj00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    107208967 (TIPARP)
Enzymes [BR:pmaj01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     107208967 (TIPARP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PARP WWE zf_CCCH_4 Torus zf-CCCH
Motif
Other DBs
NCBI-GeneID: 107208967
NCBI-ProteinID: XP_018863400
Position
9
AA seq 669 aa AA seqDB search
MASEPQAACVVPQAPCPGMKCSPAEDFSPQVRLSEKIPPVKPCFKKKQQVQKRLDTQTLR
ALRPIFTSLLGAGALDRVFVPRGQRGGHGDLCEPAVKKTLDLGTSCPQTENNVTVLMPTA
PDVQGQLAGAHPSPRHPEQDSQAGEQGFPPETPGTAADNGNESFQDHPLHPSASDGAACP
LFPDKVLEGYTSALLQENSCPVQYNLTPSNKFSAGIFQDKSEEASLDLVFELLNQLQYHT
HQEDGIEICVDFLQGTCVYGSDCPKHHTVLPYHWQVRRTATQRWQSVTNDSQEHLERLYC
NPDNDKIKVKYRGQEFWVDLNLMKIYESAEFDQMRRLSTASCPSSSSSCYTVWKYFCRDH
FGWREYSEXXXXLIEEASCRGLREVRFVTWHNQYILNIRDGFQQNSCFRREIKRRPLLRS
CVLLTPFLQTLGGSSAVPSPCSEPASTHHLSPAAVTSPSFYPETWIGMDPAQDFIQVPVL
KEDKSYRTIYNLFHKTVPETKYKILKILRVQNQFLWEKYKRKKEYMSKKMCGLDRIMNER
HLFHGTSQDVVDGICKHNFDPRVCGKHATMFGQGSYFARKASYSHNFSKRSPKGVHFMFL
AKVLTGRYTVGNHTMRRPPPVEPGSITSDLYDSCVDNYFEPQIFVIFNDDQSYPYFIIQY
EEVSSTVSI
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atggccagcgagccccaggcagcgtgcgtggtgccccaggctccctgcccaggaatgaag
tgctctcctgctgaggacttttctccccaggtgaggctgtctgaaaagatcccaccagtg
aagccttgcttcaagaagaagcagcaagtgcagaagaggctggacacacaaactctgcgg
gctctgcggccgatcttcaccagcctgctgggagctggggccttggacagggtctttgtg
ccccgaggccagcgtggtggccatggtgatttatgtgaacctgctgtgaaaaagactctg
gacctcggtacctcttgcccccagacagaaaataatgtgactgtgctgatgccaacagct
ccagatgtgcagggtcagctggcaggagctcatccttcccccaggcaccctgagcaggac
tcccaggcaggagagcaaggattccccccagaaactcctggaactgctgctgataatggt
aatgaatcattccaggatcatcctttgcacccaagtgctagtgatggtgcagcttgtcct
ctgttccctgacaaggttctggaaggctacacatctgccttgctgcaggagaacagctgt
ccagtgcaatacaacttgaccccaagcaataaattcagtgctgggatattccaggataaa
agtgaagaagcttcccttgacctggtgtttgagctcttgaaccagctgcagtatcacacc
caccaggaggatgggattgaaatctgtgtggattttctccagggaacttgtgtttatggc
agtgattgtcccaagcatcacacagtgttaccctatcactggcaggtgaggaggacagca
acccagaggtggcaaagtgtgaccaacgattcccaggagcacctggaaaggctttactgc
aaccctgacaatgacaagatcaaagtcaagtatcggggccaggagttctgggtggatctg
aaccttatgaaaatatacgaaagtgcagagttcgaccaaatgcggcgcctgtccacagcg
tcctgccccagctccagctccagctgctacaccgtgtggaaatacttctgcagggaccac
tttggctggagagagtactctgagnnnnnnnnnnngctgatcgaggaggcgagctgccgc
gggctgcgcgaggtgcgctttgtcacctggcacaaccagtacatcctcaacatcagggat
ggcttccagcagaactcctgcttccgtagggagatcaagaggaggcccctgctgcgctcc
tgcgtgctgctcacgcccttcctgcagaccctgggtggcagctccgccgtgccctccccg
tgctccgagcctgcctccacacaccacttgtcccctgctgctgtcacctctcccagcttc
taccccgagacctggattggaatggatccagctcaggacttcatccaagtgcctgttctg
aaggaagacaaaagctatagaaccatttataacctgttccacaagactgtgccagagacc
aaatacaagattttgaaaatcctgcgagtgcagaaccagttcctttgggagaagtataaa
aggaaaaaggaatacatgtccaagaagatgtgtgggctggacaggatcatgaacgagcgg
cacctgttccatggcacgtcccaggacgtggtggacgggatctgcaagcacaactttgac
cctcgggtgtgcggcaagcacgccaccatgttcggccagggcagctactttgccaggaag
gccagctactcacacaacttctccaaacgctcccccaagggcgtgcacttcatgttcctg
gccaaggtgctcacgggcaggtacacggtgggcaaccacaccatgaggaggcctccgccc
gtggagcccggcagcatcaccagcgacctctacgactcctgcgtggacaattacttcgag
ccccagatcttcgtcatcttcaacgatgaccagagctacccctattttattatccagtat
gaagaggtcagcagcactgtctccatctga

DBGET integrated database retrieval system