KEGG   Parus major (Great Tit): 107209191
Entry
107209191         CDS       T04864                                 

Gene name
AFF3
Definition
(RefSeq) AF4/FMR2 family member 3
  KO
K15195  AF4/FMR2 family member 3
Organism
pmaj  Parus major (Great Tit)
Brite
KEGG Orthology (KO) [BR:pmaj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:pmaj03021]
    107209191 (AFF3)
Transcription machinery [BR:pmaj03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     107209191 (AFF3)
SSDB
Motif
Pfam: AF-4 AF-4_C AF4_int
Other DBs
NCBI-GeneID: 107209191
NCBI-ProteinID: XP_015494046
Position
1
AA seq 1311 aa
MAARGGTRWGDSPGGTRSPGWQPLERTGRACLPLRAGRGALQRGCAPRSSGGTASPPAAP
GAPELRFLRLDVYEPDRNVLRRKEWERRNQEAQQDNGAFNTSYSLFSEPYKTNKGDELSN
RIQNTLGNYDEMKDLLTDRSNQSHLVGVPKPGVPQTSLPKTDEHLIADSRPPPPPPISST
TSSTPASLAAQQSKSTTMGWQKAGHNAASDGQQRASKHGHRSLESHKGDFKLANQKSNLE
KLKRYASSPTSSSSSSSSSSSSTSSSTSSSTSSSSSSSSSNTAQQSSLRSTLGDNINRGQ
QPAKLSCSSEGGTQVQERPAKHSGGHCVQNFPPSLASKPSLGQQKPTAYVRPMDGQDQAP
DESPKLKLPAETTKSYRGVPSSKPDSARTKSKMAKFSIPKQAEDSGTGDNSCIEEILREM
THSWPPPLSAIHTPGKAEQSKFPFPNKESQQGSTGHSNTRKSDVEPKTPEKSATHTSMLE
DDLKLSSDEEENDQQAAQRSALRVLSDSLVVPQSNARASGLSSKGSSSSSSSESETSSES
DSESESSSSESDGSKPSHYSSPEPEPPSSNKWQLDKWLNKVTPHKAPILTHHDGPALEAH
PYYGRVKAERQEGQKTPAEGPAEHRSEESRTTAAASAAGDGPRPRTANKAPGSKGSRQKS
PLAADGGPPRRAAGKKAPRRAERNSAGDGPPCPSAEEPPRSHGFPESAAAEAPRARPGGG
GCRAGHRREPRSAAAGEKRRARGPSKTAPKSKEFIETESSSSSSSSDSGSESEREERPLP
KAPAATGPEPRAAKDAGTGTASKPHGGCSAFGSINARTSSEIAKELEEQFYTLVPFGRNE
LLSPLKDSDEVKSLWVNIDLALLSRIPERLPEEPLAMSAGANQAASFPQGSSAEPPAEKG
LPKSRRKRKCENEEECRDIKKTHLERESSSRLAASAQSITTANHCNMNENSLAIPINKNE
KMLRSPVSPLSDASKHKYSSDDLTSSSRPNGSSLLPSISSSKKHKGEIQSQPHPGDFNKA
VHINSENVLLCNKPQFQTEPWSPLSTTPRDCRRTKLIFDDIPRNADYFMQEAKRKKHKAD
AMVEKFGKALNYAEAALSFIECGNAMEQGPMESKSPYTMYSETVELIRYAVRLKTHSGPN
ATPEDKQLAALCYRCLALLYWRMFRLKRDHAVKYSKALIEYFKNSSKAAQNPSPWGASGK
STGTPSPMSPSPSPVSSIGSQGSTGAPSPSPIISIPQRIHQMAANHVSITNSILHSYDYW
EMADNLAKENRDFFNDLDALMGPITLHSSMEHLVQYTQQGLHWVRNSAHLS
NT seq 3936 nt   +upstreamnt  +downstreamnt
atggcagcccgcggtgggacgcgctggggggacagccccggtgggacgcggagccccggc
tggcagcccctggagcggacaggccgtgcctgccttcccctgcgggccgggcggggtgcg
ctccaacgcgggtgcgctccgcggagcagcggcggcactgcgagcccgcccgccgcgcct
ggagcgccggagctgaggttccttcgcctggatgtgtatgagccagatagaaacgtgctg
cgaaggaaagaatgggaaaggagaaatcaggaggcccagcaggacaatggcgcatttaac
acaagctattccctcttcagtgaaccctacaagactaacaagggggatgagctttccaat
cgcatccagaatacgttgggcaactacgatgaaatgaaagacttgttaactgaccggtca
aaccagagccatctcgttggggttccaaaacctggggttcctcagacatctctccccaag
actgatgaacatcttatcgcagactcgagaccaccacctcctcctcctatttccagcact
acttcttccacaccagcatccctagctgcccagcagagcaaaagtaccacgatgggctgg
cagaaggctgggcataatgccgcttcagatggccagcagagagcaagcaaacacggacac
cggtcgctggagtcacacaagggtgacttcaaactggcgaaccaaaaatccaatctggag
aaactaaaacgctatgcatcgagtcccacctcctcctcttcttcctcttcttcttcctcc
tcttccacctcctcttccacctcctcttccacctcctcttcctcctcctcctcctcctcc
aatactgcccagcaaagctcactgaggtccacattaggagacaacatcaacagaggccag
cagccagcaaagctcagttgtagctcagaaggaggaactcaagtccaagagaggccagca
aagcacagtggagggcactgtgtccaaaacttcccaccttctcttgcttcaaagcctagt
ctgggtcagcagaagccaacagcttatgtgaggccaatggacggtcaagaccaggctcct
gatgagtctccaaagctgaagttaccagcagagacgaccaagtcatatcggggagtgcct
tccagcaagcctgattcagccaggaccaagtcaaagatggccaagttcagcattcctaag
caagcagaagacagtggaacaggagataacagctgcattgaagaaatattgcgggagatg
acccattcatggcctccgccactgtccgctattcacacaccaggaaaggcagagcaaagc
aagtttccctttccaaacaaggagtcacaacagggatctacaggacacagcaatacgagg
aaaagtgatgtagagccaaagaccccagagaaaagcgcaacccatacatcaatgctagaa
gatgacctcaagttaagcagtgatgaggaggagaatgaccagcaggcagcacagagatct
gctctccgcgttctatctgacagcctggtggtgccacagtccaatgcccgagcctcgggg
ctctccagcaaggggtcgagcagcagtagctccagtgaatccgagaccagctcagagtct
gactcagagagtgaaagcagctccagcgagagtgacggcagcaagccctcgcattactcc
agcccagagcctgagccgccctcgtccaacaagtggcagctggacaagtggctgaacaaa
gttacccctcacaaagcgcccatcctaacccaccacgatggcccggcgctggaagcccat
ccctactacggccgggtgaaggcagagcggcaggaaggacagaagaccccggctgagggc
ccggccgagcaccgcagtgaagagagccgcaccaccgccgccgccagcgccgccggggac
gggccgcggcctaggaccgccaacaaagctccaggcagcaagggcagccgtcagaagtca
cccctcgctgcggacggcgggccgccgaggcgggcagcggggaaaaaggcaccgcggcga
gccgagaggaactccgccggagacgggcccccctgccccagcgcagaggagcccccccgg
agccacggcttccctgaaagcgctgctgccgaggcgcccagggcccggcccggcggcggc
ggctgcagagcggggcaccgccgggagccccgctcagctgcagctggtgagaagcggcgg
gcccgagggccgagcaaaacggcgcccaaatccaaggagttcatcgagaccgagtcttca
tcctcatcatcctcctccgactcaggttctgagtcggagcgggaggagcgcccgctgccc
aaggcgccagcggcaaccgggcctgagccgcgggctgccaaggacgcggggaccggcacc
gccagcaaaccccacggcggctgcagtgcctttggctctattaatgccaggactagtagt
gaaatagcaaaggagctggaggaacagttttacaccctggttcctttcggtaggaatgag
ctcctgtctcctctgaaagacagtgatgaggtaaagtcgctgtgggtcaacattgacttg
gctcttttgtccaggattccagagcgtttgcccgaagaaccgctggccatgagcgccgga
gcaaaccaggcggccagcttcccgcagggtagtagtgctgaaccccccgcagagaagggt
ttaccgaaatctagaaggaaacgcaagtgtgagaatgaggaagagtgcagagacatcaag
aagactcacttagagcgagagagttcttcacgattagctgcctctgcccaaagcatcaca
acagcaaatcactgcaatatgaatgaaaatagcttggcaataccaataaataaaaatgag
aaaatgcttcggtcacccgtctctcccctctctgatgcatcaaaacacaaatattccagt
gatgatttaacttcctccagcagacctaatggcagcagtctattaccttcaatctcctcc
agcaaaaaacataagggtgaaatccagtcgcagccacatcctggagacttcaataaagca
gttcacatcaattcagaaaatgttcttctctgcaataagccacagttccaaacagagcct
tggtcacctctgtccaccacacccagggactgcagaagaacaaagcttatcttcgatgat
ataccacgcaatgcagattactttatgcaggaagctaaacggaagaagcataaagcagat
gcaatggtggagaagtttggaaaggcactgaattatgcagaagcagcactatcgtttatt
gagtgtggaaatgcaatggaacaaggcccaatggaatctaaatccccttataccatgtat
tcagaaacagttgaactcatcaggtatgctgtgagactaaaaacccactcaggccccaac
gccaccccagaagacaaacagctggcagcattatgttaccgctgcctggcccttctgtac
tggaggatgttccgactcaagagagaccacgcagtcaagtattctaaagcgcttatcgag
tatttcaagaattcatcaaaagctgcccagaacccttctccttggggtgccagtggaaag
agcacaggaactccatcacctatgtccccaagcccttctccagtcagttccataggatcc
caggggagcacgggggccccttccccatctcctatcatcagcatcccgcagcgcattcat
cagatggctgccaaccacgtcagcatcaccaacagcatcctgcacagctatgactactgg
gagatggctgacaacctggccaaggaaaacagagatttttttaatgacttggatgcattg
atgggacctatcaccttgcacagcagtatggagcatttagttcagtacactcaacaagga
cttcactgggtgcggaacagcgctcacttgtcataa

DBGET integrated database retrieval system