KEGG   Parus major (Great Tit): 107209379Help
Entry
107209379         CDS       T04864                                 

Gene name
PARP6
Definition
(RefSeq) poly [ADP-ribose] polymerase 6 isoform X1
  KO
K15258  poly [ADP-ribose] polymerase 6/8 [EC:2.4.2.30]
Organism
pmaj  Parus major (Great Tit)
Brite
KEGG Orthology (KO) [BR:pmaj00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    107209379 (PARP6)
Enzymes [BR:pmaj01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     107209379 (PARP6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PARP ARTD15_N
Motif
Other DBs
NCBI-GeneID: 107209379
NCBI-ProteinID: XP_015494507
Position
10
AA seq 643 aa AA seqDB search
MCSPNPLPNPLPHPCRLPTLCPQDLKGQYWTDDDSDGDNESEEFLYGVQGTCAADLYRHP
QLDADIEAVKEIYSENAVAVREYGTIDDVDIDLHVNISFLDEEVATAWKVLRTEPIVLRL
RFSLSQYLDGPEPSIEVFQPSNKEGFGLGLQLKKILGMFTSQQWKHLSNDFLKTQQEKRH
SWFKTSGTIKKFRAGLSIFSPIPKSPSFPVIQDSVLKGKLGIPEPRVNRLMNRSVSCMVK
NPKVEVFGYPPASTQAGVAPFNILVGGHCKNIPTLEYGFLVQIMKYAEQRIPTLNEYCVV
CDEQHVFQNGSMLKPAVCTRELCVFSFYTLGVMSGAAEEVATGAEVVDLLVAMCRAALES
PRKSIIFEPYPSVVDPNDPKTLAFNPKKKNYERLQKALDSVMSIREMTQGSYLEIKKQMD
KLDPLAHPLLQWIISSNRSHIVKLPLSRQLKFMHTSHQFLLLSSPPAKEARFRTAKKLYG
STFAFHGSHIENWHSILRNGLVNASYTKLQLHGAAYGKGIYLSPISSISFGYSGMGKGQH
RMPSKDELVQRYNRMNTIPQTRSIQSRFLQSRNLNCIALCEVITSKDLQKHGNIWVCPVS
DHVCTRFFFVYEDGQVGDANINTQDPKIQKEIMRVIGTQVYTN
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgtgttcccccaatccccttcccaaccctctcccccatccctgccgcctcccaaccctc
tgtccccaggacctcaagggccagtactggacggacgatgactccgacggggacaatgag
tccgaggagttcctctatggggtgcaggggacctgcgccgccgacctgtaccggcacccg
cagctggacgccgacatcgaggcggtgaaggagatctacagcgagaatgccgtggccgtc
agggagtacgggaccatcgatgacgtggacatcgacctccacgtgaacatcagcttcctc
gatgaggaggtggcgacggcgtggaaggtgctgcggacggagcccatcgtcctccgcctg
cgcttctccctctcccagtacctcgatggccccgaaccgtccatcgaggtcttccagcca
tccaacaaggagggcttcgggctgggtctgcagctgaagaagatcctgggcatgttcaca
tcccaacaatggaaacacctcagcaacgatttcctgaagacccagcaggagaagcggcac
agttggttcaagacgagcggcaccatcaagaagttccgtgctggtctcagcatcttctca
cccatccccaagtctcctagcttccctgttatccaagattcagtgctgaagggcaaactg
ggcatccctgagcctcgtgtgaaccgcctgatgaaccgctccgtgtcctgcatggtgaag
aatcccaaggtggaggttttcggctacccacccgccagcacccaggcaggtgttgccccc
ttcaacatcctggtcggcggccactgcaagaacatccccacactggagtatggcttcctc
gtccagatcatgaagtacgcggagcagcggatcccgacgctcaacgagtactgcgtggtg
tgtgacgagcagcacgtcttccagaacggctccatgctaaagccggccgtgtgcacccgg
gagctctgcgtcttctccttctacaccctgggcgtcatgtccggcgcggccgaggaggtg
gccacgggtgctgaggtggtggacctgctggtggccatgtgccgtgctgccctcgagtcc
cctcgcaagagcatcatctttgagccttacccctctgtggtggaccccaacgaccccaaa
actctggccttcaaccccaagaagaagaactatgagcggctgcagaaggccctggacagt
gtgatgtccatccgggagatgacccagggctcctacctggagatcaagaagcagatggac
aagctggaccccctggcacatcccctcctgcagtggataatctccagcaacagatcccac
attgtcaagctgcccctcagcaggcagctgaagttcatgcacacctcccaccagttcctc
ctgctcagcagccccccggccaaggaagcccggttccgcacggccaagaaactctacggc
agcaccttcgctttccatggctctcacattgagaactggcattccatcctccgcaatggg
ctggtcaacgcctcctacaccaaactgcagctgcatggagcagcctatggcaagggcatc
tatctgagccccatctccagtatttcctttggatactcaggaatggggaaagggcagcac
cggatgccgtcgaaggatgagctggtgcagagatacaatcggatgaacacgatcccccag
acccgctccatccagtcccgcttcctccagagccgcaacctgaactgcatcgcgctgtgc
gaagtgatcacctccaaggacctgcagaaacacggcaacatctgggtctgccctgtctcg
gaccatgtctgcacacgcttcttctttgtgtatgaagatggccaagtgggagatgccaat
atcaatactcaggaccccaaaatccagaaggagatcatgcgtgtgatcgggactcaggtg
tacacaaactga

DBGET integrated database retrieval system