KEGG   Parus major (Great Tit): 107210494Help
Entry
107210494         CDS       T04864                                 

Gene name
ABHD6
Definition
(RefSeq) monoacylglycerol lipase ABHD6
  KO
K13700  abhydrolase domain-containing protein 6 [EC:3.1.1.23]
Organism
pmaj  Parus major (Great Tit)
Brite
KEGG Orthology (KO) [BR:pmaj00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:pmaj01002]
    107210494 (ABHD6)
Enzymes [BR:pmaj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     107210494 (ABHD6)
Peptidases [BR:pmaj01002]
 Serine Peptidases
  Family S33
   107210494 (ABHD6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Ndr DUF1057 Thioesterase DLH
Motif
Other DBs
NCBI-GeneID: 107210494
NCBI-ProteinID: XP_015496880
Position
12
AA seq 337 aa AA seqDB search
MDLDVLNMFVIAGGTLAIPILAFVASFLLWPSALIRIYYWYWRRALGMQVRYANYDDYQF
CYSYRGRPGYRPSILMLHGFSAHKDMWLSIVKFLPKNLHLVCVDMPGHEGTTRSDLDDYS
ISGQAKRIHQFVECIKLNRKPFHLVGTSMGGNVAGVYAAQYPEDICSLTLICPAGLPSTT
DSKFIKQLRELQESKRIDRIPLIPSTPEEMADMLKLCSYVRFKVPQQILQGLVDVRIPHN
EFYRKLFLEIVDEKSRHSLHEHMSKIKAPTQVIWGKQDQVLDVSGATALANAIPDCHVYI
LENCGHSVVVERPRKTANLILEFLALLHGIDNNKKQA
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atggacctggatgtgctgaacatgtttgtcattgccggcggcaccctggctatccccatc
ctggccttcgtggcctcgttcctcctctggccctcggcgcttatccgcatctactactgg
tactggcgccgagccttgggcatgcaggttagatatgcaaactacgatgactatcagttt
tgttattcctatagaggaagacctggataccgaccatccatcctgatgttacatggcttc
tcagctcacaaagacatgtggctctccatagtcaagttcctgccaaagaacctgcacttg
gtatgtgtggacatgcctgggcacgagggcacgacccgctcggacttggatgattactcc
attagtgggcaagctaagagaatacaccagttcgtggagtgcatcaagctgaacagaaag
ccctttcatctggttggcacttccatggggggaaatgttgctggtgtctatgctgctcag
tacccagaagatatttgcagcctgaccctcatctgtcctgcaggcctgcccagtaccact
gacagcaagttcattaagcagctccgggagctgcaggagtccaaacgcattgacaggatc
cctttaatcccctccacgcccgaggagatggcagacatgctgaagctttgctcctacgtt
cgtttcaaggtgccacagcagatcctccagggccttgttgacgttcgcatcccacacaat
gaattttaccggaaattgtttttagaaatcgtggatgaaaagtccaggcactctctgcac
gagcacatgagcaagatcaaagcaccgacacaggtcatctggggaaagcaggaccaggtc
ctggatgtttctggtgccactgctttagcaaacgctattccagactgccacgtgtacatc
ctggagaactgtgggcactcggtggtggtggagcggccccgcaagacagccaacctcatc
ctggagttcctggcgctgctgcatggcatagataacaacaagaagcaggcatga

DBGET integrated database retrieval system