KEGG   Parus major (Great Tit): 107210780Help
Entry
107210780         CDS       T04864                                 

Gene name
GPX3
Definition
(RefSeq) glutathione peroxidase 3
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
pmaj  Parus major (Great Tit)
Pathway
pmaj00480  Glutathione metabolism
pmaj00590  Arachidonic acid metabolism
pmaj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmaj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    107210780 (GPX3)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    107210780 (GPX3)
Enzymes [BR:pmaj01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     107210780 (GPX3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx
Motif
Other DBs
NCBI-GeneID: 107210780
NCBI-ProteinID: XP_015497539
Position
13
AA seq 229 aa AA seqDB search
MGGCSRSNWILPLFLAGLVQLGRSEEREKVDCYHSVKDTIYSYGALTLDGDEYIPFERYK
GKTVLFVNVATYUGLTLQYVELNALQDELRSQGVVVLGFPSNQFGKQEPGQNSEILPALK
YVRPGGGFVPNFQLFQKGDVNGAKEQKIFTFLKNACPPVAEEFGNPNKLFWEPLRNHDIK
WNFEKFLVSPEGVPIMRWYHRTNISVVKNDIISYLRRRQQENHDEQQEQ
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atggggggctgctcccgcagcaactggattttgccccttttcttggctgggctcgtccag
ctggggcgaagtgaggagagggagaaggtggactgctaccactcggtgaaggacaccatc
tacagctacggggccctgaccctcgatggggacgagtacattccctttgagaggtacaag
gggaagacagtgctcttcgtcaacgtagccacatactgaggcctgacgctgcagtatgtt
gaactgaatgcactacaagatgagctgagaagccagggagttgtggtccttggcttccct
tccaaccaatttgggaagcaggaacctggccagaactcagagatcctccctgcgcttaag
tatgtccggccaggaggtggctttgttcccaacttccagctgttccagaaaggggatgtg
aacggggccaaggagcagaagatcttcaccttcctgaagaacgcctgtcccccggtggcg
gaggagtttgggaaccccaacaagctcttctgggagcctctgcggaaccatgacatcaag
tggaactttgagaagttcctggtgagccctgagggcgtgcccatcatgcgctggtaccat
cgcaccaacatctccgtggtgaagaatgacatcatttcctacctgaggcggcggcagcag
gaaaaccatgatgaacagcaggagcagtag

DBGET integrated database retrieval system