KEGG   Parus major (Great Tit): 107212053
Entry
107212053         CDS       T04864                                 

Gene name
ADAMTS13
Definition
(RefSeq) A disintegrin and metalloproteinase with thrombospondin motifs 13 isoform X1
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
pmaj  Parus major (Great Tit)
Brite
KEGG Orthology (KO) [BR:pmaj00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pmaj01002]
    107212053 (ADAMTS13)
Enzymes [BR:pmaj01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     107212053 (ADAMTS13)
Peptidases and inhibitors [BR:pmaj01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   107212053 (ADAMTS13)
SSDB
Motif
Pfam: TSP1_ADAMTS TSP_1 ADAM_CR_2 Reprolysin ADAM_spacer1 TSP1_spondin Reprolysin_4 Reprolysin_3 Reprolysin_2 Reprolysin_5 TSP1_CCN Peptidase_M10 DUF3810 Fve
Other DBs
NCBI-GeneID: 107212053
NCBI-ProteinID: XP_015500327
Position
17
AA seq 1399 aa
MTVSLALRALAVLPLGLCWLPEKFLGALDAEGVLAYFGTSSVPDVPEFVVAEPTCPCKEE
HFGLRPCRVQHCSIQAWGQLYAFEFLEEHALLSSSFVSSQVVNSSFVLLKRFPENCFAGG
KPLQPPGARSRVTYCGGQLQGVVTVGEGEEIHIRPVRSKDVALLRDLGFSSPHILFKSAA
REAKPARAGWAPPRLHKRAEAAVKHLELMVVAGPDVYLYHKEDTERYVLANLNIGAELLR
DASLGAHFRVHLMQMLVLREPEAEVNITANITSSLISVCEWSKKVNPQNDSDPQHADIVL
YITRFDLELPDGNKELRGVTQLGGVCSSFWSCVITQDTGFDLGVTIAHEIGHSLGIAHDG
EGNLCSSSGYIMGSAGNNNNIDLTWSPCSREQFLTLVSTGQTSCLNDLPDMDGSIPGWKP
GLYYGADEQCKIAFGSVATACTFADSSVDICKVLSCHVQPADKSSCTRLLVPLLDGTECG
FNKWCSKGQCSSLEDLNPMAVVHGHWSAWSPLSPCSRSCGGGVVLRQRFCNNPRPAFGGQ
ECHGTSMQAEMCNTQACLMTQQDFMAEQCVATNLKPLYLDVETPSFYTWTSAVGFAKGDL
LCKHMCRAVGKEFMVSRGDSFLDGTRCEQDGTEQHRDLHLCVMGRCRAFGCDGQMGSRKA
MDSCKVCGGDNSTCTQVSGSYTEGKAKEYVTFLSLPYNTTSVHVTNRRPLFTHLAVKVKG
EYVVAGKGRISLNVTYPSVLEDKQIKYQVFLTQDNLPSLEEIHVDGPTQEEIEIQVYRRY
TKEYGNATNPSITFSYFVPRENLTYLWIPQQGPCSVTCGEGVQPVAHVCFDQSKNEVTED
QWCLELPQPLPEHKPCAMEPCLYRWKTSQRGECSAVCGTGVARQNLTCVQSRDGLETVVD
DSLCPGEEKPLSFVPCVVNVCPLGWDKEEDAHLLQPLESLGHVQLENRTVYVWSPVAGEC
SVSCGRGKTQLHYVCVAFDTKEETQEENCQPVPKPESRVEICDLNPCPPRWKVTPAGPCS
SSCGLGLAVQLVTCVQLLHGQEVLQEEHLCPVAEKPPSSVPCVIRACSYEWSFSEWSECS
TSCGNGIQTRQDFCLSSLTRKPVNPLFCRHFPKALVVRGCSAGPCPEQEGTLSPGPELQP
VTPATQLATAAAATQHRHKDLDVPLSAGPWEQTEPGRGVCGNLFLSATGIINMTGTESRD
CTVAIGRPLREEILVTILESSLNCSAGEVLLFSGRMMWRTGCRKLPLSLINSRTNTLIVK
QRVVLPGNGVILQYNSRTATKKYYQDCDQQLFGPQGEIVNPVQLPDERQEVVCRTFITVA
PRQRISIRALNTDLGPEGNHTHFNYILVRDVSTMKTVVFHGKQQFLWQSTGSQAEIEFHE
NVKDHRTHFWAEYHAIEPK
NT seq 4200 nt   +upstreamnt  +downstreamnt
atgaccgtcagcttggcgctgcgggcgctcgccgtgctcccgctggggctgtgctggctt
cctgagaaattcctcggtgctttggatgcggaaggtgttttggcttactttggaaccagc
tcagtgcctgatgtacctgagtttgttgtggctgagccaacttgcccttgtaaagaagaa
cattttgggctgaggccctgtcgggtccagcattgctccatccaggcctggggccagctc
tatgcctttgaattcctggaggagcatgccctcctttcctcctcctttgtgagcagccag
gtggtgaactcttcctttgttttactgaagagattcccagaaaactgctttgcaggtgga
aaacccctgcagcctcctggggccaggagcagagtcacttactgtggagggcagctgcaa
ggagtcgtcaccgtgggtgagggtgaggagattcacatcaggccagtcaggagcaaagat
gtggctctgctgagggaccttggcttctccagcccccacatcctcttcaaaagtgctgca
agagaggcaaagccagccagagcagggtgggctcctcctcgcctgcacaagagggctgag
gcagctgtcaaacatttggagctgatggtggtggcagggccagatgtttacttgtaccac
aaagaggacacggagcgatatgtcctggccaacctgaacattggagcagagctgctcaga
gacgcctcactgggggctcatttcagagttcacctcatgcaaatgctggttttgagagaa
cctgaggcagaggtgaacatcacagccaacatcacctcctccctcatcagtgtctgtgag
tggagcaagaaggtgaacccccagaatgactctgacccccagcatgctgacattgtcctc
tacatcaccaggtttgacctggagttgcctgatgggaacaaggagcttcgtggagtgact
cagttagggggagtctgctcctccttctggagctgtgtcattacccaggacactggcttt
gaccttggagtcaccatagcccatgagattgggcacagccttggcattgcccacgacgga
gaggggaatctgtgcagcagcagtggttacatcatgggctcagcaggaaacaacaacaac
atcgacctcacctggtctccgtgcagtcgggagcagttcctcacccttgtcagtacaggc
caaacaagctgcttgaatgacctgccggacatggatggcagcatcccggggtggaagcct
ggcttgtactacggagcagatgagcagtgtaaaatagcctttgggagtgtggccacagct
tgcaccttcgctgacagcagtgttgacatctgcaaagttctctcatgccatgtacaacca
gcagacaaatccagctgtactcggcttctggtccccctcctggatggaactgagtgtggg
ttcaacaagtggtgctccaagggtcagtgcagctctctggaggacctgaaccccatggct
gtggtccatgggcactggtctgcctggagccccctctccccctgctcccgcagctgcggc
gggggggtggtgctgaggcagcgcttctgtaacaaccccaggcctgcttttggggggcag
gagtgccacggtaccagcatgcaagcagagatgtgcaatacacaggcctgtctgatgacc
cagcaggacttcatggctgaacaatgtgtagcaacaaatttaaagccactgtaccttgat
gtagaaacaccatccttttatacctggacctctgctgttggctttgccaaaggggacctg
ctctgcaagcacatgtgcagggctgtgggcaaggagttcatggtgagccgtggggacagt
ttcctggatggaaccaggtgtgagcaggatggcacggagcagcacagggatctccatctc
tgtgtgatggggagatgcagagcattcgggtgtgatggccagatgggttccaggaaggcc
atggactcctgcaaggtctgtgggggtgataactccacttgcacccaagtgagtggatcc
tacacagaagggaaagctaaagagtatgtgacatttctgtccctaccctacaacaccacc
tcggtccatgtcaccaacaggaggcctctcttcacacacctggctgtgaaggttaaagga
gagtatgtggtggctggaaaaggaagaatctcactgaatgtcacctacccgtcagttctg
gaggacaagcagatcaaataccaagtgttcctcacccaggacaacctgccaagcctggag
gaaatccacgtggatgggccaacacaggaagaaattgaaatacaggtctacaggaggtac
acaaaagaatatggcaatgccaccaacccatccatcaccttcagctactttgtccccagg
gagaacctgacctatctgtggattcctcagcagggcccgtgttcagtgacctgtggggaa
ggggtgcagccagtggctcatgtgtgctttgatcagagcaagaatgaggtaacagaggat
cagtggtgtctggagctgccacagcccctcccagagcacaagccctgtgccatggagccg
tgcctctacaggtggaagacgtctcagagaggtgaatgctctgctgtctgtgggactgga
gttgccaggcagaacctgacctgtgtgcagtcccgtgatggcctggagactgtggtggat
gacagcttgtgcccaggagaagaaaaacccctctcctttgtgccatgtgtggtcaatgtc
tgccctttgggctgggacaaagaggaagatgcacacttacttcagcctctggagtcactt
gggcatgtccagctggaaaatcggactgtgtatgtctggagccctgtagctggggagtgt
tctgtctcctgtgggagaggtaagactcagctgcactatgtttgtgtggcttttgacacc
aaagaagaaacccaggaggaaaactgtcagccagtgccaaagccagaaagcagggttgaa
atctgtgatctcaacccctgcccaccaaggtggaaggtaaccccagctgggccctgctcc
tccagctgtgggctgggcttagcagtgcagctggtcacctgtgtgcagctcctccatggc
caggaggtcttgcaggaggaacatttgtgccccgtggcagagaagccccccagcagtgtc
ccctgtgtcatccgagcgtgctcttacgagtggagcttcagcgagtggtcagagtgttca
acatcctgtggaaatggcattcagaccaggcaggatttctgcctcagctctctgacccgc
aagcccgtgaacccccttttctgccgccacttccccaaggccctcgtggtgcgtggctgc
tccgcagggccctgtcctgagcaggaggggaccctgtcccctgggccagagctgcagcca
gtgacaccagccacacagctggcaacagctgcagctgccacacagcacagacacaaggac
ctggatgtccctctgtctgctgggccctgggagcagacagagcccggtcgaggtgtgtgt
gggaacctctttctcagtgccactggcatcatcaacatgacaggcacggagagcagggac
tgcacggtggccatcgggcgtcccctgagggaggagatcttggtcaccatcctggagagt
tccctcaactgcagtgcaggtgaggtcctgctgttttctgggcgaatgatgtggcggaca
ggctgcaggaagctccctctgtcactgataaattccagaaccaacacactgattgtgaaa
cagcgtgttgtgctgccaggaaatggggtcattctgcagtacaacagcagaactgcaacc
aaaaaatattaccaagactgtgaccagcagctgtttggcccccagggtgaaatagtgaat
cctgtgcagttgcctgatgagaggcaggaggtcgtgtgtcggactttcatcacggtggct
ccgcggcagcgcatctccatccgtgccctcaacactgacctgggccctgagggcaaccac
acacacttcaactacatcctggtccgagatgtcagcaccatgaagacagtggtgttccat
gggaagcagcaattcctgtggcagtcaacaggaagccaagctgaaattgaattccatgaa
aatgttaaggatcacagaacccatttctgggctgaataccatgctattgagcccaaataa

DBGET integrated database retrieval system