KEGG   Parus major (Great Tit): 107212340Help
Entry
107212340         CDS       T04864                                 

Gene name
CACNG5
Definition
(RefSeq) voltage-dependent calcium channel gamma-5 subunit
  KO
K04870  voltage-dependent calcium channel gamma-5
Organism
pmaj  Parus major (Great Tit)
Pathway
pmaj04010  MAPK signaling pathway
pmaj04260  Cardiac muscle contraction
pmaj04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:pmaj00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107212340 (CACNG5)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107212340 (CACNG5)
   04261 Adrenergic signaling in cardiomyocytes
    107212340 (CACNG5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:pmaj04040]
    107212340 (CACNG5)
Ion channels [BR:pmaj04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   107212340 (CACNG5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Claudin_2 PMP22_Claudin DUF716
Motif
Other DBs
NCBI-GeneID: 107212340
NCBI-ProteinID: XP_015500931
Position
18
AA seq 279 aa AA seqDB search
MLLAMSACSRKALTLLSSVFAVCGLGLLGISVSTDYWLYLEEGIVQPQNQTAEIKLSLHS
GLWRVCFLAGEERGRCFTIEYVMPMNIQLTSESTINVLKMIRSATPFPLVSLFFMFIGFI
LSNIGHIRPHRTILAFVSGIFFILSGLSLVVGLVLYISSINDEMLNRTKDSESFFNYKYG
WSFAFSAISFLLTESAGVMSVYLFMKRYTAEDLYRPHPSFYRPRLSNCSDYSGQFLHPDA
WARGRSPSDISSEASLQMNSNYPALLKCPDYDQMSSSPC
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgctgttggcaatgagcgcctgcagcaggaaggcgctgaccctgctcagcagcgtgttc
gccgtctgcggcctcggcctcctgggcatctccgtcagcaccgactactggctctacctg
gaggagggcatcgtccagccccaaaaccagacggcggagatcaagctctcgctgcactcg
gggctctggagggtctgctttctggcaggtgaggagcgtggccggtgcttcaccattgaa
tacgtcatgcccatgaacatccagctgacgtccgaatccacaatcaatgtcctgaagatg
atccgctctgccacccccttccctctggtcagcctcttcttcatgttcatcggcttcatc
ctgagcaacatcggccacatccggcctcacaggaccatcctcgccttcgtctcggggata
ttcttcatcctgtcaggtctgtcactggtggtggggctggtcctctacatatccagcatt
aacgatgagatgctcaacaggaccaaggactcggagtcgttcttcaattacaaatacggg
tggtcctttgccttctctgccatctcgttccttctcacagagagtgccggggtgatgtct
gtctacctgttcatgaagcgctacacggccgaggacctctacagaccccaccccagcttc
taccggccccgcctgagcaactgctccgactactcggggcagttcctgcacccggacgcg
tgggcacggggccgcagcccctcggacatctccagtgaggcgtccctgcagatgaacagt
aactacccagccctgctcaagtgccctgactacgaccagatgtcctcgtccccgtgctga

DBGET integrated database retrieval system