KEGG   Parus major (Great Tit): 107212642Help
Entry
107212642         CDS       T04864                                 

Definition
(RefSeq) probable low-specificity L-threonine aldolase 2 isoform X3
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
pmaj  Parus major (Great Tit)
Pathway
pmaj00260  Glycine, serine and threonine metabolism
pmaj01100  Metabolic pathways
pmaj01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pmaj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    107212642
Enzymes [BR:pmaj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     107212642
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 107212642
NCBI-ProteinID: XP_015501634
Position
18
AA seq 364 aa AA seqDB search
MRRAMARAAVGDDDYGEDPAVNELQRLAAGTLGTESALFVPTATMANLIAVMSHCQRRGA
QLFLGQDSHLHLYEHGGAAQVAGVHTQALPDLPNGTFDLDQLELTIREAHGSRYHPRPEL
ICLENTHSSAGGRALPLTYLRQVRGLADRYGLRVHMDGARLLNAAVAQGVQPAQIAQHCD
SVSLCFSKGLGAPAGAVLAGCREFVSEAWRVRKLLGGGMRQAGVLAAAARLGLQRAEATL
RRDHTNARRFAEGIHVLDSPLLSINLAAVETNIVMVNVQGTWPSPAELCGRLRAVSEEEV
AETGQAVSVLLLPWSARTVRAVWHRDISDRDTELARRKLEFVARKCQEELALGLHPMSPG
TGGA
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgcgccatggcccgcgccgccgtgggcgacgacgactacggggaggacccggca
gtgaacgagctgcagcgcttggccgcggggactctgggaacggaatcggctctgttcgtg
cccacggccaccatggcaaatctcatcgccgtgatgagccactgccagcgcaggggggct
cagctgttcctgggccaggacagccacctgcacctctacgagcacggcggggccgcgcag
gttgccggtgtgcacacccaggcactgccagatctgccgaatggcacatttgacctggac
cagctggagctgaccatccgtgaggcccacggcagccggtaccacccgcgccctgagctc
atctgcctggagaacacacacagctcggcagggggccgggcactgcccctcacctatctc
aggcaggtccgtgggctcgctgaccgttacgggctgcgggtgcacatggacggcgcacga
ctgctgaatgcagcagtggcccagggtgtgcagccagctcagattgcccagcactgtgac
tctgtgtccctctgcttctccaagggcctgggtgccccggctggtgcggtgctggcaggg
tgcagggagtttgtctccgaggcctggcgtgtgcggaagctgctgggcgggggcatgcgg
caggcgggagtgctggcggctgctgcccgcctcgggctgcagcgcgcggaggcgacactt
cgcagagaccacaccaacgcccggcgctttgcagaaggtatccatgtgctggactctccc
ctcttatccatcaacctggcagcggtggagaccaacattgtgatggtaaatgtccagggg
acctggccatcccccgctgagctctgcggccgcctgcgtgccgtcagcgaggaggaggtg
gctgagactgggcaggctgtcagcgtcttgctgctcccctggtcagcacggactgtgcgt
gctgtctggcaccgcgacatctcggaccgtgacaccgagctcgcaaggagaaagctggaa
tttgtggccaggaagtgccaggaggaactggccttgggactgcatccgatgtctccaggc
actgggggagcctga

DBGET integrated database retrieval system