KEGG   Parus major (Great Tit): 107212904Help
Entry
107212904         CDS       T04864                                 

Gene name
MTMR4
Definition
(RefSeq) myotubularin-related protein 4 isoform X1
  KO
K18082  myotubularin-related protein 3/4 [EC:3.1.3.48 3.1.3.64 3.1.3.95]
Organism
pmaj  Parus major (Great Tit)
Pathway
pmaj00562  Inositol phosphate metabolism
pmaj01100  Metabolic pathways
pmaj04070  Phosphatidylinositol signaling system
pmaj04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:pmaj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    107212904 (MTMR4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    107212904 (MTMR4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107212904 (MTMR4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pmaj01009]
    107212904 (MTMR4)
Enzymes [BR:pmaj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     107212904 (MTMR4)
    3.1.3.64  phosphatidylinositol-3-phosphatase
     107212904 (MTMR4)
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     107212904 (MTMR4)
Protein phosphatases and associated proteins [BR:pmaj01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    107212904 (MTMR4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myotub-related FYVE Y_phosphatase DSPc Y_phosphatase3
Motif
Other DBs
NCBI-GeneID: 107212904
NCBI-ProteinID: XP_015502272
Position
19
AA seq 1254 aa AA seqDB search
MPLPAEEPVPAAPPSLHPLHFLSRPWRRRSDGRAGLGGPGREVESARPPPALPPLSAAAA
AAPARAAGGRDAPALPGGAGTLPQCRGRSSQPEGGDAACACPALLPPREMNMSLPGRVSC
SMLNCFGEEGPPSLEYIQAKDLFPPKELIKEEESLQVPFTVLQGEGVEYLGHANDAVIAI
SNYRLHIKFKDSVINVPLRMMESVECRDMFQLHIICKDSKVIRCHFSTFKQCQEWLKRLT
RAIARPAKPEDLFAFAYHAWCLGVCVDEEDQHAHLCRPGDHVRFRFEMELVRMSFDLQNA
WRVSDINNNYKLCSSYPQKLLVPVWITDKELENVASFRSWKRIPVVVYRHARSGAVIARC
SQPEISWWGWRNADDEYLVTSIAKACALNPGVRAPGAAPHTGSSDGSEPCDTDFDSSLTA
CSGVENVGTPQKLLILDARSYTAAVANRAKGGGCECEEYYPNCEVVFMGMANIHSIRNSF
QYLRAVCSQVPDPSNWLSALESTKWLQHLSVMLKAAVLVSSAVDREGRPVLVHCSDGWDR
TPQIVALAKILLDPYYRTMEGFQVLVESDWLDFGHKFGDRCGHQEKVEDQNEQCPVFLQW
LDAVHQLLKQFPCLFEFNEAFLVKLVQHTYSCLYGTFLGNSPCEREMHNIPKRTCSVWSL
LRAGNKNFHNLLYMPGSEQVLHPVCHVRALHLWTAVYLPASSPHPLGQEDMDIYMPPGSQ
SQDFSVRCLDRLPKTRSMDDLLSACDSSSPLTRTSSDPNLNNHCQEVRVGLEAWNANTEG
AEGAAVATGEARPREEKEENPPLQGSSCAEHEGPSRQAAVPASSVPVEVEKGSGTHMEEL
DGVGPDPNPSGQENSDKVSTSSGKHLETCPQEPLKAAGTVSSAGGCPKRITTHQDIPSQE
SLAPGTPAQDIPGFALGIPCSDADKGRGDAGRSVPFEEPGQPGRLLLEQWRKPISQSQSS
EFSFLGSNWDSFQGMVTSLPNGEPAARHLLSYGCCSKRLSSKPLRAPGLCLSGPWSGREG
GKPSACAGHVSSHFGKPSRFWLPCHLKQASGPKHLPPKCPSPVPPLYLDDDGLPFPTDVI
QHRLRQIEASYKQEVEQLRRQVRELQLRLDIRHFCAPPAEPPMDYEDDFTCLKESDGSDT
EDFCSDHSEDCLSEASWEPVDKKETEVTRWVPDHMASHCFNCDCEFWLAKRRHHCRNCGN
VFCATCCHLKLPIPDQQLYDPVLVCNSCYDHIQVSRARELMSQHMKKPIATASS
NT seq 3765 nt NT seq  +upstreamnt  +downstreamnt
atgccgctcccagccgaggagcccgtgcccgcggccccgccatccctccacccgctccat
tttctgtctcgcccgtggcggagacgctcagatggcagagccgggctcggcggccctggg
agggaggtggagtctgcccgtcctccgcccgccctccctccattgtcagcggcggcggca
gcggcacctgctcgggccgccggcggccgggatgctcctgcccttcccggcggagcgggg
acgctgccgcagtgccggggccgcagctcgcagccggagggaggagatgctgcttgtgcc
tgcccggccctgctgccgcctcgggaaatgaacatgagtctgccaggccgcgtctcctgc
tccatgctcaactgctttggtgaggaaggccctcccagtttggagtacatccaggccaag
gacttgttccccccgaaggagctcataaaggaggaggagtctctgcaggtgccgttcact
gtgctgcagggtgagggggtggagtacctgggccatgccaatgacgctgtgatcgccatc
tccaactaccgcctgcatatcaaattcaaggactctgtgatcaatgtgcctttgagaatg
atggaaagcgtggagtgtcgggatatgttccagcttcacatcatctgcaaggactccaaa
gtgatcaggtgccatttctccaccttcaagcagtgccaggagtggctgaagaggctgact
cgagccattgcccgccctgccaagcccgaggacctctttgcatttgcctaccacgcctgg
tgcttgggggtgtgtgtggatgaggaggatcaacacgcccatctctgccggccaggggac
cacgtgaggttccggttcgagatggagctggtgaggatgagcttcgacctgcagaacgcc
tggcgcgtctctgacatcaacaacaactacaagctttgttccagttatccccagaagctg
ctggtccctgtctggatcaccgacaaggagctggagaacgtggcttcattcaggtcatgg
aagaggatccctgtggtggtgtacagacacgcgcgcagcggggcggtgatcgcgcgctgc
agccagcccgagatcagctggtggggctggcgcaacgccgacgacgagtacctggtgaca
tccattgccaaagcctgtgccttgaaccccggcgtgagagcgccgggcgccgcgccgcac
accgggagcagcgacggcagcgagccctgcgacaccgacttcgactcgtcgttgacagcg
tgttcgggcgtggagaacgtgggaacccctcagaagctgctgattctcgatgccaggtcc
tacacagcagccgtggccaacagggccaagggaggaggctgcgaatgtgaagagtattac
cccaactgtgaagtcgtgttcatgggcatggccaacatccactccatccggaacagcttc
cagtatctgcgtgctgtctgcagccaggtgccagaccccagcaactggctttcagccctg
gagagcaccaagtggctgcagcacctctctgtcatgctgaaggcagcagtgctggtctcc
agtgctgtggacagagaagggcgcccagtgctggttcactgctctgacggctgggacagg
actccacagatcgtggcactggcaaagattctcctggacccttactacaggaccatggag
ggcttccaggtgcttgttgagtcggactggctggattttggtcataagtttggggatcgc
tgtggacaccaggagaaggtggaagatcagaatgagcagtgcccagtttttctccagtgg
ctggatgctgttcatcagcttctgaagcagtttccctgcctcttcgaatttaatgaagct
tttctggtgaagctggtgcagcacacgtactcctgcctctacgggaccttcctggggaac
agcccttgcgagcgcgagatgcacaacatccccaagcgcacgtgctccgtctggtccctg
ctgcgggccggcaacaagaacttccacaacctgctctacatgcccgggtctgagcaggtg
ctgcatcccgtgtgccacgtgcgtgccctgcacctctggacagccgtgtacctgccagcc
tcctcaccacacccgctgggacaggaggacatggacatctacatgccccccggatctcag
agccaggacttcagcgtcaggtgtttggacagattaccaaagacaagatctatggatgac
ctgctctcagcctgtgactccagcagccctttgacacgcacatccagtgaccccaacctg
aacaaccactgtcaggaggtgcgggtgggcttggaagcctggaatgccaacactgagggg
gctgaaggtgctgcagtggccacgggagaggcacggcccagggaggagaaggaggagaac
cctcccttgcaaggcagcagctgtgctgagcacgaagggccgagcaggcaggctgctgtg
ccagccagcagtgtccctgtggaggtggaaaagggcagtggaacacacatggaggaactg
gatggcgtagggccagatccaaatccttccggacaggaaaacagcgacaaggtttccacc
agttctggaaagcatttggaaacctgtccccaggaacctttgaaggctgctggcacggtg
tccagtgcaggaggctgtcccaaaagaatcaccacccaccaagacattcccagccaggag
tccctggcaccaggcacccctgctcaggacatcccaggctttgccctgggtatcccgtgc
tcagatgcagacaagggcagaggtgatgctggcaggagcgtgccctttgaggagcctggc
cagccagggaggctcctgctggagcagtggcgcaagcccatttcccagagccaaagcagt
gagttctccttcctggggtccaactgggacagttttcaaggcatggtgacatcgctcccc
aatggggagcctgcagccagacacctcctctcctatggctgctgcagcaagaggctgagc
agcaagcccctgcgggccccaggcctgtgcctcagtggcccctggtctggcagggaaggt
gggaagccctcggcctgtgctggccacgtgagctcgcattttgggaagcccagccgtttc
tggctgccctgccacctgaaacaagcctctggtcccaagcatctgcccccaaaatgtccc
tctcctgtgcctcccctctacctggacgacgacgggctgccgttccccacggatgtgatc
cagcaccggctgcggcagatcgaggccagctacaagcaggaggtggagcagctgcgccgg
caggtgcgggagctgcagctgcgcctggacattcgccacttctgcgcccctccggccgag
ccccccatggactacgaggatgactttacgtgtctgaaggagtcggatggcagcgacaca
gaggatttctgttctgaccacagtgaggactgtttgtcggaagcaagctgggaacctgtg
gataagaaggagactgaggtgacgcggtgggtcccagaccacatggcctcgcactgcttc
aactgcgactgtgagttctggctggccaaacggaggcaccactgcaggaactgtgggaat
gtgttctgtgctacctgctgccatctgaagctgcccatccctgatcagcagttgtatgac
cctgtcctcgtttgtaactcctgttatgaccatatccaagtgtctcgtgccagggagctc
atgagccaacatatgaagaaacccattgccacagcttccagctga

DBGET integrated database retrieval system