KEGG   Parus major (Great Tit): 107213319Help
Entry
107213319         CDS       T04864                                 

Gene name
GSS
Definition
(RefSeq) glutathione synthetase
  KO
K21456  glutathione synthase [EC:6.3.2.3]
Organism
pmaj  Parus major (Great Tit)
Pathway
pmaj00270  Cysteine and methionine metabolism
pmaj00480  Glutathione metabolism
pmaj01100  Metabolic pathways
pmaj04216  Ferroptosis
Module
pmaj_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:pmaj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    107213319 (GSS)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    107213319 (GSS)
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    107213319 (GSS)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pmaj04147]
    107213319 (GSS)
Enzymes [BR:pmaj01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     107213319 (GSS)
Exosome [BR:pmaj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107213319 (GSS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSH_synth_ATP GSH_synthase MerR_1
Motif
Other DBs
NCBI-GeneID: 107213319
NCBI-ProteinID: XP_015503100
Position
20
AA seq 474 aa AA seqDB search
MAAGWQDVLRDAVAVRDAAAVAVDAALLAGVLMRTGEQPHASDVVNYAPFTLLPSAVPRA
LFEQAYAVQQDFNLLVDAVSQNKEFLEQTLASTIKVDDFTARLFRIYMQVLEEGLAQTVF
LGINRSDYMFDCGLDGAAALRQIEINTIAASFAGLTSRTADVHRLVLQVLGKTEEASHLL
PNNPAKGLALGIAKAWELYGSQRAVVMFLVEEVQRNIFDQRCIENELWNRNIAVVRKRFR
DVFEQGSLDASRRLYVDGQEVAVVYYREGYVPQVYDQQNWEARLLLERSRAVKCPDIATQ
LAGTKKVQQELSRPGTLEKLLPGRPEAIARIRATFAGLYSLDQGEEGDKIAATAIADPDR
FVLKPQREGGGNNLYGEELREVLEKIKDSPERTSYILMDKIKPQPALNYLLRAHSPLQMS
KCISELGIFGVYVRQGQELVLNQAAGHLLRTKAIEHADGGVAAGVAVLDTPYLV
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgggctggcaggacgtgctgcgggacgcggtggccgtgcgggacgcggcggcg
gtggcggtggacgcggcgctgctggcgggggtgctgatgcggaccggggagcagccccac
gcctcggatgtggtgaattacgcgcccttcacgctgctcccgtccgcagtgccacgggcc
ttgtttgaacaagcctacgctgtccagcaggattttaacctgctggtggatgctgtcagt
caaaacaaagaattcctggagcaaactctggccagcaccatcaaggtagacgacttcaca
gctcgactcttcagaatctacatgcaggttttggaggaaggcttggctcagactgtgttt
ttgggcatcaaccgctcggattacatgtttgactgtgggctggatggcgcagcagctctg
aggcagatagaaataaacaccattgctgccagcttcgctgggctcacctcccgcaccgcc
gacgtccacaggttggtgttgcaagtgctgggaaagaccgaggaggcgtcacacctgctg
cccaacaacccagcaaaggggctggccttggggattgccaaagcctgggagctctacggg
tcccaaagggctgtggtgatgtttctggtggaagaagtccagaggaatatttttgatcag
cgttgtatagaaaatgagctttggaacaggaatatcgctgtggtcaggaagcggttccgg
gatgtgtttgagcagggctccctggatgccagcaggaggctgtatgtggacggccaggag
gttgcagtggtgtattacagagagggctacgtgccccaggtctacgaccagcagaactgg
gaggcgcggctgctgctggagcggtcccgggcagtgaagtgtcccgacattgccacgcag
ctggcgggcaccaagaaggtgcagcaggagctcagcaggcccgggacgctggagaagctg
ctgcccggccgccccgaggccatcgctcgcatcagagccacctttgcaggactctactcc
ctggaccagggtgaagaaggtgacaaaatagctgccacagccatcgctgaccccgaccgc
tttgtgctgaagcctcagcgtgaaggtggagggaacaacctctatggtgaagagctcagg
gaggttctggagaagatcaaagacagccctgagagaacctcctacatcttgatggataag
atcaaaccccagccagcactgaattacttgctgagggctcacagtcccctccagatgtcc
aagtgcatctctgagctcgggatctttggtgtctatgtgaggcagggccaggagctggtg
ctgaaccaggccgccggtcacctcctgcgcaccaaggccatcgagcacgcggacggcggc
gtggcggccggggtggccgtgctggacacaccgtacctggtgtga

DBGET integrated database retrieval system