KEGG   Parus major (Great Tit): 107213689Help
Entry
107213689         CDS       T04864                                 

Definition
(RefSeq) stromelysin-1-like
  KO
K01394  matrix metalloproteinase-3 (stromelysin 1, progelatinase) [EC:3.4.24.17]
Organism
pmaj  Parus major (Great Tit)
Brite
KEGG Orthology (KO) [BR:pmaj00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:pmaj01002]
    107213689
Enzymes [BR:pmaj01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.17  stromelysin 1
     107213689
Peptidases [BR:pmaj01002]
 Metallo Peptidases
  Family M10
   107213689
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M10 Hemopexin PG_binding_1 Reprolysin_3 DUF4953 Reprolysin_5 Reprolysin_4 Metallopep
Motif
Other DBs
NCBI-GeneID: 107213689
NCBI-ProteinID: XP_015503884
Position
1
AA seq 479 aa AA seqDB search
MRMENLLFLLLLCAALSCAFPASMRHPKEEDVQLIQKYLENYYGFKKDGEPFVWKSNNAM
TQKLKEMQEFFGLEVTGKLDSGTLDLVQKHRCGFPDVAGFSTFAGEPKWTKQVLTYRIVN
YTPDLHPADVNSAIKKALSVWSSVTPLRFIKKDRGDADIMISFAARGHNDFIPFDGPGGS
LAHAYAPGKDFGGDAHFDEDETWTKSTEGANLFYVAAHEFGHSLGLSHSKDPSALMYPVY
RKFDPSVHLLHQDDITGIQYLYGSSPNTNNDQRESTEIKDPTESKDPALPNSCSSNLTFD
AVTTFRGEIMFFKDKHIWRKHPAVRTVDFELVSSFWPQLPPGVDAAYEIPEKDEMVIFKG
NEFWVVRGDTILPGYPQKLYTLGFSKDVTKIDAAFHNGIEGKTYYFIADKFWSYDKRSQS
MDRKPLLLRDAFPGINGKIDAVFQHENFLYFFSGRKQVEFDLDKKRVTRFLKTNFWFPC
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgagaatggaaaatctcctatttctcctattattatgtgcagcactttcttgtgctttt
cctgcaagtatgagacatcccaaggaagaagatgtgcagcttatccagaagtacctggaa
aattactatggctttaagaaagatggggagccttttgtttggaaaagtaataatgcaatg
acccaaaaactaaaggaaatgcaggaattcttcgggttggaggtgacagggaaactggat
tctggcactttggacttggtacagaaacaccgctgtggattccctgacgtagctgggttc
tccacctttgcaggagagccaaaatggacaaaacaagtcttgacatacaggatagtgaac
tacacaccggatctgcacccagcagatgtcaactcagcgatcaagaaagcgttaagtgtt
tggagcagtgtgaccccactgagattcatcaagaaggacagaggtgatgcagacataatg
atctcctttgcagccagaggtcacaatgacttcatcccctttgatggcccaggaggctcc
cttgcccatgcctatgcacctggaaaggactttggtggagatgctcactttgatgaggat
gaaacatggaccaaaagcacagagggcgcgaacttgttttatgttgctgcccatgagttt
ggccactcactgggactttctcattccaaagaccccagtgctctgatgtatccagtttac
aggaaatttgacccttcagtacatcttcttcatcaggatgatattactggcatacagtac
ctctatggatcatctcctaacacaaacaatgatcaaagggaatctactgagataaaagac
ccaactgagtcaaaagatcctgcactgccaaacagctgcagctccaatttaacgtttgat
gctgtcaccactttccgtggagaaataatgttctttaaagacaagcatatttggcgcaaa
catccagcagtcagaacagttgactttgagttggtatcttcattctggccacagctgcca
cctggtgtcgatgctgcatatgaaattcctgaaaaagatgaaatggtcatttttaaaggg
aatgaattctgggttgtgagaggagataccatacttcctggatacccccaaaaactctac
accctgggcttttcaaaggatgttaccaaaattgatgctgcttttcataatggaattgag
gggaaaacatattacttcatagcggacaaattttggagttatgataaaagaagtcagtct
atggataggaagccattactgctaagagatgcatttccaggaattaatgggaagattgat
gctgtttttcaacatgaaaacttcctttatttcttcagtggaagaaagcaagttgagttt
gaccttgataagaagagagttacacgcttcctaaagacaaacttttggtttccatgttaa

DBGET integrated database retrieval system