KEGG   Parus major (Great Tit): 107213933
Entry
107213933         CDS       T04864                                 

Gene name
AHRR
Definition
(RefSeq) aryl hydrocarbon receptor repressor
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
pmaj  Parus major (Great Tit)
Brite
KEGG Orthology (KO) [BR:pmaj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pmaj03000]
    107213933 (AHRR)
Transcription factors [BR:pmaj03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    107213933 (AHRR)
SSDB
Motif
Pfam: PAS HLH PAS_3 PAS_11 PAS_9 DUF1505
Other DBs
NCBI-GeneID: 107213933
NCBI-ProteinID: XP_015504343
Position
2
AA seq 759 aa
MIPPGECLYAGRKRRKPIQKQRPAVGNEKSNPSKRHRDRLNAELDHLASLLPFPPDIVSK
LDKLSVLRLSVSYLRVKSFFQAIQEKHFKKQAGQTIKEDNISNKTAVQEGGLLLESLNGF
ALVVSADGMIFYASSTIVDYLGFHQTDVMHQNIYDYIHVDDRQDFCRQLHWAMNPPQMFS
GQQLQSETGEEYILSKLFKAQENDSMTTDYSSFLTRCFICRVRCLLDSTSGFLTMQFQGK
LKFLFGQRKKSSSGTVLPPQLSLFCIVVPLLLPSVTEMKMKSLLVKAKHKADDAAAANTN
SSSKGSSGFCEATELYGRNNHHEGAAFSNALQIAENQIKAKNNGENGISLVKVQTNEDHW
VWVQANTQLLYRSGCSEYVLAQQQMLKEEDEQLKILNGFASLKGNLEGLSYNSAIETLGQ
WKHLNWAAVKNEQDNVKVKFEPHTNGECFMQEEPLSSNTSVLGIQNNCTTNSSWTLRNSS
SCSMSQRLNMCPNRRAGSFYNRDQNFLNLASTCSSHWGSAENGQSYSGLQQRCAENYATD
HLKLQRPLISSESLYDTAIPLEMPIKTEYDSDSENIADNYLLSQSRAWLDESGSVRKQVS
SYPNRMHLKTEPDLCEPALPCQKSRHCLYTPHNWQCIIANHPNNLNLNRACKGSRNKEMA
PFFPQSSSACLENMPDLPHTACYSHFYSPSPGEEKEQVNEGFKMPCEFKNPCLVQAIKRE
PLDSPPLSNSGQNTVHASFPENTLAGPVPRKTTECTFLQ
NT seq 2280 nt   +upstreamnt  +downstreamnt
atgattcctccgggggaatgcctgtatgctgggaggaaaaggaggaaacccattcaaaaa
caaaggcctgcagttgggaatgagaaatccaatccttcaaagagacacagagaccgcctg
aatgcagaactggaccacctggccagcctccttccttttccacctgacatcgtatcaaag
ctggacaaactttctgtcttgcgccttagtgtcagctatctccgagtcaaaagtttcttt
caagccattcaagaaaagcactttaagaagcaagctggtcaaacgataaaagaagacaat
atatctaataagactgctgtacaagaaggtggacttctactggaatcactgaatggtttt
gccttggtggtgagtgcagatggaatgatattctatgcatcatcaacaattgtggactat
ctagggtttcatcagactgatgtaatgcaccaaaacatatatgattacattcatgtggat
gaccgccaggatttttgtagacaactgcactgggccatgaatcctccccagatgttttct
ggacagcaactacagtcagaaacaggagaagaatatattctcagtaaattgttcaaagca
caggagaatgacagcatgacaacagattattcttcctttctaactcgctgtttcatctgt
cgagttcgctgcttgttggacagtacttctggattccttacaatgcaattccaaggcaaa
ctaaagttcctctttggacaaagaaagaagtcctcatcaggaacagtattgccacctcag
ctgtccttattctgcatagtggtaccacttctgctcccttctgtgacagagatgaagatg
aaaagcctgcttgtgaaagcaaaacacaaagctgatgatgcagcagcagcgaacacaaac
tccagttcaaaaggaagttcaggattttgtgaagcaacagaattatatggaagaaacaat
caccatgaaggtgctgccttcagtaatgcattacagattgctgaaaaccaaatcaaagca
aagaataatggagaaaatggcatttctctagtcaaagtacaaacaaatgaagatcactgg
gtctgggttcaagctaacactcaacttctgtatcgaagtggttgttcagaatatgtcctt
gcccaacagcaaatgttaaaggaagaagatgaacagctgaagatactaaatggttttgcc
agtttgaaaggaaatctggagggactttcctataacagtgccattgaaactctgggccag
tggaagcatcttaactgggcagcagtgaagaatgaacaagataatgtaaaagtgaagttt
gagcctcatactaatggtgagtgttttatgcaagaggaacctctcagttccaacacatca
gttttaggcattcaaaacaactgcaccacaaacagtagctggactttaagaaactcaagt
tcttgttctatgagccagagactgaacatgtgcccaaacaggagagctggatcattctac
aacagagaccaaaatttcttaaatttggcatcaacttgttcttcccactgggggagtgca
gaaaatggccagtcttactcggggctccaacagcgctgtgcagagaactatgcaacagac
catctgaagctgcagagaccattaatatcctcagagtctctttatgacacagccattccc
ttggagatgcctatcaaaacagaatatgactctgattctgaaaacattgccgataactac
ctgctttcgcagagccgagcctggctggatgagagcggctcggtgagaaagcaggtgtcc
agctatccaaacagaatgcacctcaaaacagaaccggacctctgcgagccagccttgccc
tgccagaagtcaaggcactgcctttatacaccccataattggcaatgcatcatagcaaac
catcccaacaacctgaacttgaacagagcttgcaagggttcacggaacaaggagatggcc
ccatttttccctcagagctcctccgcgtgtttggagaacatgcctgacctgccacacaca
gcttgctacagccacttctacagccccagcccaggggaggagaaagagcaggttaatgag
gggttcaaaatgccatgtgaatttaaaaatccttgcttggttcaagcaatcaagcgtgag
ccccttgattctccaccattgtccaacagtggacagaacacagtacatgcgagcttccct
gaaaatacattagcaggtcctgtgcctcgtaaaaccactgaatgtacatttttgcaatag

DBGET integrated database retrieval system