KEGG   Parus major (Great Tit): 107215177Help
Entry
107215177         CDS       T04864                                 

Gene name
DHX8
Definition
(RefSeq) ATP-dependent RNA helicase DHX8
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
pmaj  Parus major (Great Tit)
Pathway
pmaj03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:pmaj00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    107215177 (DHX8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:pmaj03041]
    107215177 (DHX8)
Enzymes [BR:pmaj01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     107215177 (DHX8)
Spliceosome [BR:pmaj03041]
 Complex C
  Other components
   Step II factors
    107215177 (DHX8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OB_NTP_bind HA2 S1 Helicase_C DEAD AAA_22 T2SSE AAA_19 PRP38_assoc Flavi_DEAD AAA_30 Spem1 AAA_16 PhoH Sigma54_activ_2 Transformer ABC_tran
Motif
Other DBs
NCBI-GeneID: 107215177
NCBI-ProteinID: XP_015506665
Position
27
AA seq 1191 aa AA seqDB search
MAELAAAEELAKLEYLSLVSKVCTELDNHLGINDKDLAEFVISLAEKNTTFDTFKAILLK
NGAEFTDSLISNLLRLIQTMRPPPKPSSSKEAAVKPKSEKEKLRELYPALCRPDNPNIRN
MLDEDDVKVAADALKELEALMPSADKGKQRSSDHRVKKRKRSRSRSRDRKRRHRSRSRSR
SRTWDRNRGKSRYRSRSRSWSPSKDRKDRDKYLEKSHERWRDKHIDRPPAEEPSIGDIYN
GKVTSIMQFGCFVQLEGLRKRWEGLVHISELRREGRVANVADVVSKGQRVKVKVLSFTGS
KTSLSMKDVDQDTGEDLNPNRRRNLVGEINEETSMRNPDRPSHLSLVSAPEVEDDSLERK
RLTRISDPEKWEIKQMIAANVLSKEEFPDFDEETGILPKVDDEEDEDLEIELVEEEPPFL
RGHTKQSMDMSPIKIVKNPDGSLSQAAMMQSALAKERRELKQAQREAEMDSIPMGLNTHW
VDPLPDVDGRQIAANMRGIGMMPNDIPEWKKHAFGGNKASYGKKTQLSIIEQRESLPIFR
LKEQLIQAVHDNQILIVIGETGSGKTTQITQYLAEAGYTSRGKIGCTQPRRVAAMSVAKR
VSEEFGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPDLTQYAIIMLDEAHE
RTIHTDVLFGLLKKTVQKRQDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEILYT
KEPETDYLDASLITVMQIHLTEPPGDILVFLTGQEEIDTACEILYERMKSLGPDVPELII
LPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKT
GIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTV
LSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPML
CKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQTEGDHLTLLAVY
NSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKATVRVQKAICS
GFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQPEWVVYHELVLTTKEYMREVTTID
PRWLVEFAPAFFKVSDPTKLSKQKKQQRLEPLYNRYEEPNAWRISRAFRRR
NT seq 3576 nt NT seq  +upstreamnt  +downstreamnt
atggcggagctggcggcggccgaggagctcgccaagctcgagtacctgtcgctggtctcc
aaggtctgcaccgagctcgacaaccacctgggcatcaacgacaaggacctggccgagttt
gtgataagtcttgccgagaaaaataccacgtttgacacatttaaagcaattcttctgaag
aatggtgctgagttcactgattccctcattagtaacttgctacgtctcatacagacaatg
cggcctccaccaaaaccatccagcagcaaagaggcagctgtcaaacccaaatcagagaaa
gagaagttgagggagttgtatccagccctttgcaggccagacaatcccaacatcaggaat
atgctggatgaagatgatgtgaaagtggcagctgatgccctgaaagaactcgaagctctg
atgcctagtgcagacaagggcaagcagaggagcagcgaccatcgagtgaagaaaaggaag
aggagccgaagtcgtagcagggacaggaagcgaaggcacagatctcggtccaggtctcgt
tccaggacttgggataggaacaggggaaaatccagataccggtcaaggagcagaagttgg
agtcccagtaaggaccgcaaggatcgagacaagtaccttgagaagagccatgagaggtgg
agagacaagcacatagaccgtccaccagctgaggagccttccatcggagacatctacaac
ggcaaagtcacgagcataatgcagtttgggtgctttgtgcagctggaaggactaaggaaa
cgttgggagggtttggttcacatctcagagctgcgaagagaaggacgggttgccaacgtt
gctgatgttgtgagcaaaggccaaagagtgaaagtcaaagtgttatcttttactggatcc
aaaaccagcctgagcatgaaggatgttgatcaagacaccggggaagacttgaacccaaac
cgtagaaggaacctggttggagaaatcaatgaggaaacatccatgaggaacccagacagg
cccagtcacttgtccctggtgagcgcccccgaggtggaggacgacagcctggaacggaaa
cgcctcacccgcatttcagaccccgagaagtgggaaataaaacagatgattgcagctaat
gtgctttccaaggaagagtttcctgacttcgatgaggagactgggattcttcctaaagtt
gatgatgaagaagatgaggatcttgagattgagctagttgaagaggagccaccatttctt
cgaggtcacaccaaacagagcatggatatgagtcccattaaaatagtaaagaatccagat
ggttccttgtcccaggctgcaatgatgcaaagtgctttagctaaagagaggcgagaactt
aaacaagcccagagagaagcagagatggattccatccccatgggcctcaacacacactgg
gtggatcctctccctgatgtggatggaagacaaatagctgcaaacatgcgaggtattggg
atgatgccaaatgatatcccagagtggaagaaacatgcatttggtggcaacaaagcttct
tatggtaagaagacacagctttccatcattgaacagagagagagtctcccaatcttcaga
ctgaaggagcagctgatacaagctgtgcatgacaaccagattctgattgttattggagag
acaggatctgggaaaacaacccagattacccaatacctggctgaggcaggatatacctca
agaggaaagattggatgtactcagcctcgcagagtggctgcaatgtctgtagcaaagaga
gtgtcagaagaatttggttgctgcttgggacaagaggttggctacaccattcggtttgaa
gactgcaccagccctgagactgtcatcaagtacatgacagatgggatgttactgagagag
tgcctgatagacccagatctgacccagtatgccattatcatgctggatgaggcccatgag
aggaccatacatacagatgtgctctttgggctcctgaagaagacagtccagaaaaggcag
gacatgaagttgatagtgacatcagcaacactggatgctgtgaaattctctcagtatttc
tatgaagcaccaatcttcacaattcctggcagaacatacccagtagaaattctgtacaca
aaagagccagagacagattatttggatgccagtctgattacagtaatgcagatccattta
acagagccaccaggtgatattttggtctttctaactggccaggaagagattgacactgcc
tgtgaaatcctctatgagaggatgaaatctctaggacctgatgttccagagttaattatc
ctgccagtatattcagctttgcccagtgaaatgcagaccaggatctttgacccagcccca
ccagggagcagaaaggttgtcattgccaccaacattgcagagacatctttgactattgat
ggaatatattatgtggttgatcctggctttgtgaagcagaaagtctataactccaagact
ggaattgaccagctggtggtgacaccaatttctcaggctcaagccaagcagcgtgcagga
agggctgggagaacaggcccaggaaaatgttacaggttatacacagaacgtgcatataga
gatgagatgttaaccaccaacgtgcctgaaatccagagaacaaatctggccagcacagtg
ctctccctgaaggctatgggcatcaatgatttgctgtcctttgactttatggatgctccc
cccatggaaactctgataactgccatggagcagctctacaccctgggagctctggatgat
gaggggctgctcactcgacttgggcgcaggatggcagaattccccttggagcctatgctg
tgtaagatgttgatcatgtctgtgcatctggggtgcagtgaggagatgctgaccattgtc
tccatgctgtctgtgcagaatgtgttctacaggccaaaggataagcaagcacttgctgat
caaaagaaagccaagttccatcaaacagaaggtgaccacctcacgctgctggctgtgtac
aattcctggaagaataataagttttcaaatccctggtgctatgaaaattttatccaggcc
cgatccttacgccgggcacaggacattcgcaagcagatgttgggcatcatggacaggcat
aagctggatgtggtgtcctgtgggaaggcaacagttcgggtccagaaggccatttgcagt
ggcttcttcagaaatgcagcaaagaaggatccccaggaagggtacaggacactcattgac
cagcaagttgtctacatccacccatccagtgctctcttcaacaggcagcctgagtgggtg
gtgtatcacgagctggtgctgaccaccaaggaatacatgcgggaggtgacaaccatcgat
cctcgctggctggtggagtttgccccagctttcttcaaggtctctgatccaaccaagctg
agcaagcagaagaagcagcagcggctggagcccctctacaaccgctacgaggagcccaac
gcctggaggatatcccgtgccttccggcggcgatga

DBGET integrated database retrieval system