KEGG   Pseudomonas mandelii: OU5_2796Help
Entry
OU5_2796          CDS       T03626                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pman  Pseudomonas mandelii
Pathway
pman00071  Fatty acid degradation
pman00072  Synthesis and degradation of ketone bodies
pman00280  Valine, leucine and isoleucine degradation
pman00310  Lysine degradation
pman00362  Benzoate degradation
pman00380  Tryptophan metabolism
pman00620  Pyruvate metabolism
pman00630  Glyoxylate and dicarboxylate metabolism
pman00640  Propanoate metabolism
pman00650  Butanoate metabolism
pman00900  Terpenoid backbone biosynthesis
pman01100  Metabolic pathways
pman01110  Biosynthesis of secondary metabolites
pman01120  Microbial metabolism in diverse environments
pman01130  Biosynthesis of antibiotics
pman01200  Carbon metabolism
pman01212  Fatty acid metabolism
pman02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pman00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    OU5_2796
   00630 Glyoxylate and dicarboxylate metabolism
    OU5_2796
   00640 Propanoate metabolism
    OU5_2796
   00650 Butanoate metabolism
    OU5_2796
  09103 Lipid metabolism
   00071 Fatty acid degradation
    OU5_2796
   00072 Synthesis and degradation of ketone bodies
    OU5_2796
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    OU5_2796
   00310 Lysine degradation
    OU5_2796
   00380 Tryptophan metabolism
    OU5_2796
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    OU5_2796
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    OU5_2796
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    OU5_2796
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pman04147]
    OU5_2796
Enzymes [BR:pman01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     OU5_2796
Exosome [BR:pman04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   OU5_2796
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AHZ69875
UniProt: A0A024EBC6
Position
complement(3150254..3151531)
Genome map
AA seq 425 aa AA seqDB search
MTQLRRVAIIGGNRIPFARSNGPYATASNQAMLTAALEGLIERYNLHGLRIGEVVAGAVL
KLSRDMNLTRECVLGSRLSPGTPAYDIQQACGTGLEAALLVANKIALGQIECGIAGGVDT
TSDAPIGVSEGLRRVLLQANRAKTTGDKLKTFLQLRPRDLIPEFPRNGEPRTGLSMGQHC
ELMAQTWNIPREEQDQLALESHRNLAASYAEGWHNDLMTPFLGLTRDNNLRPDLILEKLA
SLKPAFEKSAKGTMTAGNSTPLTDGASLVLLGSEEWAKERGLPILAYLRDGEAAAVDFVN
GAEGLLMAPVYAVPRLLARNGLTLQDFDYYEIHEAFAAQVLCTLKAWEDPEYCKTRLGLD
APLGSIDRSRLNVKGSSLAAGHPFAATGGRIVANLAKLLDAAGKGRGLISICAAGGQGVT
AIIER
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgacccagctgcgccgcgtcgcgattattggcggtaaccgaatccccttcgcccgctcc
aacgggccttacgccaccgccagtaaccaggcgatgctcaccgcagcgctcgaaggcctg
atcgaacgctacaacctgcatggcctgcggatcggcgaagtggtcgcgggggcggtcctc
aagctgtcccgagacatgaacctgacgcgcgagtgtgtgctcggttcacggttgtccccc
ggcaccccggcctatgacattcagcaggcgtgcggcacgggccttgaagcggcgttgctg
gtggcgaacaagattgctttgggacagatcgagtgcggcattgccggtggcgtcgatacc
acctcggatgcgccgatcggcgtcagtgaaggtttgcgcagggtgctgctgcaagccaat
cgcgccaagaccaccggcgacaaactgaaaacctttctgcagctgcgtccccgggacttg
ataccggagttcccgcgcaacggcgaaccgcgcaccggtttgtccatgggccagcactgc
gagttgatggcccaaacctggaacatcccccgcgaagaacaggatcagctggcgctggag
agccatcggaacctggccgcgtcctacgccgaaggctggcacaacgacctgatgacaccg
ttcctcggcctgacccgcgacaacaacctgcgcccggacctgatcctggaaaaactcgct
tcgctgaaaccggccttcgagaaaagcgccaagggcacgatgacggcgggcaactccacg
ccgctcaccgatggcgcgtcgctggtactgctgggcagtgaagaatgggcgaaggaacgt
ggcttgccgatcctcgcctatttgcgtgacggcgaggccgcggcagtggatttcgtcaac
ggcgccgaagggctgttgatggcgccggtgtacgcggtgccccgtttgctggcgcgcaat
ggcctgaccttgcaggacttcgattactacgaaatccacgaagccttcgccgcgcaggtg
ctctgcacgttgaaggcctgggaagatccggagtattgcaaaacccgtctcggcctcgat
gcgccgctgggctccatcgaccgcagccgcctcaacgtcaaaggcagttcactggcggcc
gggcatccgtttgccgcgaccggcgggcgcatcgtcgccaacctggcgaagttgctcgac
gcggcgggcaagggccgaggcttgatctcgatctgcgccgctggcggccaaggggtgacg
gcgattatcgagcgctga

DBGET integrated database retrieval system