KEGG   Pseudomonas mandelii: OU5_2839Help
Entry
OU5_2839          CDS       T03626                                 

Gene name
purH
Definition
(GenBank) bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase
  KO
K00602  phosphoribosylaminoimidazolecarboxamide formyltransferase / IMP cyclohydrolase [EC:2.1.2.3 3.5.4.10]
Organism
pman  Pseudomonas mandelii
Pathway
pman00230  Purine metabolism
pman00670  One carbon pool by folate
pman01100  Metabolic pathways
pman01110  Biosynthesis of secondary metabolites
pman01130  Biosynthesis of antibiotics
Module
pman_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:pman00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    OU5_2839 (purH)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    OU5_2839 (purH)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pman04147]
    OU5_2839 (purH)
Enzymes [BR:pman01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.3  phosphoribosylaminoimidazolecarboxamide formyltransferase
     OU5_2839 (purH)
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.10  IMP cyclohydrolase
     OU5_2839 (purH)
Exosome [BR:pman04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   OU5_2839 (purH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AICARFT_IMPCHas MGS
Motif
Other DBs
NCBI-ProteinID: AHZ69918
UniProt: A0A024EC46
Position
3194325..3195944
Genome map
AA seq 539 aa AA seqDB search
MEIEMTDQTTRLPIRRALISVSDKTGILEFAKELEALGVEILSTGGTFKLLRDNGVAAVE
VADYTGFAEMMDGRVKTLHPKIHGGILGRRGIDDAIMNEHGIKPIDLVAVNLYPFEATIN
KPGCDLPTAIENIDIGGPTMVRSAAKNHKDVAIVVNASDYASVLESLKAGGLTYAQRFDL
MLKAFEHTAAYDGMIANYMGTVNQAADTLSTSGRSEFPRTFNSQFVKAQEMRYGENPHQS
AAFYVEAKPAEVGIATATQLQGKELSYNNVADTDAALECVKSFVKPACVIVKHANPCGVA
VSPDAEGGIRQAYELAYATDTESAFGGIIAFNRELDAETAKAIVERQFVEVIIAPSVSEE
ARAIVAAKANVRLLACGEWSADRAAAWDYKRVNGGLLVQSRDIGMISADDLKVVTKRAPT
EQEINDLIFAWKVAKYVKSNAIVYAKNRQTIGVGAGQMSRVNSARIAAIKAEHAGLQVAG
SVMASDAFFPFRDGLDNAAKVGITAVIQPGGSMRDAEVIAAADEAGIAMVFTGMRHFRH
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atggaaattgaaatgaccgaccagactacccgcctgccgatccgccgcgccttgatcagc
gtttccgacaagaccgggatcctcgaattcgccaaagagcttgaagccctgggcgtcgag
atcctctccaccggcggaacgttcaagctgctgcgcgacaacggtgttgccgcagtggaa
gtcgcggactacaccggtttcgcagaaatgatggacggtcgggtgaaaaccctgcacccg
aaaatccacggcgggatcctcggtcgtcgcggtatcgacgacgccatcatgaacgagcac
ggcatcaagccgatcgacctggtcgcggtcaacctgtacccgttcgaggccaccatcaac
aagccaggctgcgacctgccgaccgccatcgaaaacatcgacatcggcggcccgaccatg
gtccgctcggcggcaaaaaaccataaagacgtggccatcgtggtcaatgccagcgactac
gccagcgtccttgaaagcctcaaggctggcggcctgacctatgctcagcgtttcgacctg
atgctcaaggccttcgaacacaccgcggcctacgacggcatgatcgccaactacatgggc
accgtgaaccaggccgctgacaccctctcgacctccggtcgcagcgagttcccgcgcacc
ttcaacagccagttcgtcaaggctcaggaaatgcgctacggcgagaacccgcaccagagc
gcggcgttctacgtggaagccaagcctgccgaagtcggtatcgccaccgcgacccaactg
cagggcaaagagctgtcgtacaacaacgtggccgacaccgacgccgcgctggaatgcgtg
aaaagcttcgtcaagccggcttgcgtgatcgtcaagcacgccaatccgtgcggcgttgcg
gtcagcccggacgcagaaggcggtatccgtcaggcttacgaactggcttacgccaccgac
accgagtccgcgttcggcggcatcatcgccttcaaccgcgagctggatgctgaaaccgcc
aaggccatcgtcgagcgtcagttcgtcgaagtgatcatcgcccctagcgtcagcgaagaa
gcccgcgccatcgtggcggccaaagccaatgtgcgcctgctggcctgcggcgagtggtcg
gctgatcgcgccgctgcctgggactacaaacgcgtcaacggcggtttgctggtacagagc
cgcgacatcggcatgatcagcgccgacgacctgaaagtcgtgaccaagcgtgccccgacc
gagcaggaaatcaacgacctgatcttcgcctggaaagtcgccaaatacgttaaatccaac
gccattgtctacgccaagaaccgtcagaccatcggcgtcggcgctggccagatgagccgc
gtgaactccgcccgtatcgccgcgatcaaggctgaacatgccggtttgcaagtggcgggc
tcggtgatggcctccgatgcgttcttcccgttccgcgacggcctggacaacgcggccaag
gtcggtatcaccgcggtgatccagccgggtggctcgatgcgtgatgcggaagtgattgcc
gctgctgatgaagctggcatcgccatggtcttcaccggcatgcgccacttccgtcactga

DBGET integrated database retrieval system