KEGG   Pseudomonas mandelii: OU5_2950Help
Entry
OU5_2950          CDS       T03626                                 

Gene name
psd
Definition
(GenBank) phosphatidylserine decarboxylase proenzyme
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
pman  Pseudomonas mandelii
Pathway
pman00564  Glycerophospholipid metabolism
pman01100  Metabolic pathways
pman01110  Biosynthesis of secondary metabolites
Module
pman_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:pman00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    OU5_2950 (psd)
Enzymes [BR:pman01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     OU5_2950 (psd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-ProteinID: AHZ70029
UniProt: A0A024EAS3
Position
3334971..3335831
Genome map
AA seq 286 aa AA seqDB search
MNKRLFILSQYLLPHHLLSRLAGCIAECRVRWFKNAFTAWFAKRYQVDMSQALVEDLTAY
EHFNAFFTRALKDGARPLDETPGAILSPADGAVSQLGPIEHGRVFQAKGHSFSVLELLGG
DAANAAPFMGGDFATIYLSPKDYHRVHMPLAGTLREMVYIPGRIFSVNQTTAENVPELFA
RNERVACIFDTERGPMAVVLVGAMIVASIETVWAGLVTPPKRELKTFRYDEAARAPIHLE
KGAELGRFKLGSTAVVLFGPDQVKWAEGLGALSPVQMGQALGLPAA
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgaataagcgtttgtttatcctcagccaatacctgctgcctcaccacttgctctcgcga
ctggccggctgcattgccgaatgccgcgtgcgttggttcaagaatgcctttaccgcctgg
ttcgccaagcgctatcaggtggacatgtcccaggcgctcgtcgaagacctgacggcttac
gagcacttcaacgcgttcttcacccgcgccttgaaagacggcgctcgcccgctcgatgaa
accccgggcgccattctcagcccggccgacggtgcggtcagccaactcggcccgatcgaa
catggccgcgtgttccaggccaagggccacagtttcagcgtgctggaattgctgggcggt
gatgccgccaatgctgcgccgttcatgggcggcgactttgcgacgatttacctgtcgccg
aaagactaccaccgcgtgcacatgccgctggccggcaccctgcgcgagatggtctacatc
ccgggccggattttctcggtcaaccagaccaccgccgaaaacgtgccggaactgtttgcc
cgcaacgaacgtgtggcgtgcattttcgacaccgagcgcgggccgatggccgtggtgctg
gtgggcgcgatgatcgtggcgtcgattgaaaccgtgtgggccgggctggtgacgccgccg
aaacgcgagctgaaaaccttccgttacgacgaagccgcccgcgcgccaatccatctggaa
aaaggtgcggaactgggtcgcttcaagctgggttcgaccgctgtggtgctgttcgggccg
gatcaggtgaagtgggctgaagggctcggcgccctgtcgccagtacaaatgggccaggcg
ctgggcctgccagcagcctga

DBGET integrated database retrieval system