KEGG   Pseudomonas mandelii: OU5_3440Help
Entry
OU5_3440          CDS       T03626                                 

Gene name
glyS
Definition
(GenBank) glycyl-tRNA synthetase subunit beta
  KO
K01879  glycyl-tRNA synthetase beta chain [EC:6.1.1.14]
Organism
pman  Pseudomonas mandelii
Pathway
pman00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:pman00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    OU5_3440 (glyS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pman01007]
    OU5_3440 (glyS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pman03016]
    OU5_3440 (glyS)
Enzymes [BR:pman01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     OU5_3440 (glyS)
Amino acid related enzymes [BR:pman01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   OU5_3440 (glyS)
Transfer RNA biogenesis [BR:pman03016]
 Prokaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    OU5_3440 (glyS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA_synt_2f DALR_1
Motif
Other DBs
NCBI-ProteinID: AHZ70519
UniProt: A0A024EC66
Position
3887693..3889747
Genome map
AA seq 684 aa AA seqDB search
MSAQDFLVELGTEELPPKALNTLADAFLAGIDKGLQAAGLNYETKTVYAAPRRLAVLITS
LATQQPDRSINLDGPPRQAAFDAEGNPTQAALGFAKKCGVDLSEIDQSGPKLRYSQSIAG
KPTASLLPTIVEDSLNDLPIPKRMRWGARKEEFVRPTQWLVMLLGDQVIDCTILAQKSGR
DSRGHRFHHPESVRITSPANYLSDLRAAYVLADANERRELISKRTEELATMQEGTAIVPP
ALLDEVTALVEWPVPLVCSFEERFLDVPQEALITTMQDNQKYFCLLDADGKLLPRFITVA
NIESKDPQQIIAGNEKVVRPRLTDAEFFFKQDKKQKLEDFNLRLQNVVFQEKLGSVYDKA
ERVSKLAAFIAQRIGGNAAWASRAGLLSKCDLATEMVGEFPEMQGVAGYYYALNDGEPEE
VALALNEQYMPRGAGAELPTTLTGAAVAIADKLDTLVGIFGIGMLPTGSKDPYALRRAAL
GVLRILIDKKLDLDLNDAVAFAVNAFGTKVKAAGLNDSVLEFIFDRLRARYEDEGVDVGT
YLSVRALKPGSALDFDQRVQAVEAFRKLPEAAALAAVNKRVSNLLSKVEGSIPSVVEAKY
FDNANEFSLYSAIQQADQAVQPMAAARQYSESLARLAALREPVDAFFEAVMVNAEDAKVR
ANRYALLARLRGLFLGVADISMLG
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atgagtgctcaagattttctggttgaactgggcaccgaagaactgccacccaaagccctg
aacaccctggccgacgcgttcctggccggtatcgacaagggcttgcaagccgcaggcctg
aactacgagaccaaaaccgtctacgccgcaccacgtcgtctggctgtgctgatcacctcg
ttggcgactcagcagccggatcgcagcatcaacctcgacggcccgccacgtcaggccgcg
ttcgatgccgaaggcaacccgactcaagcagcactgggcttcgccaagaaatgcggcgtc
gacctgagcgaaatcgatcaaagcggcccgaaactgcgttacagccaaagcatcgccggc
aagccgactgcgagcctgctgccgaccatcgttgaagattcgctgaacgacctgccgatc
cccaagcgcatgcgctggggtgctcgcaaggaagaattcgttcgtccgacccagtggctg
gtaatgctgctcggtgaccaggtcatcgattgcacgatcctcgcccagaagtccggtcgt
gattcccgtggtcaccgcttccatcacccggaaagcgtgcgtatcacttcgccggccaat
tacctgagcgacctgcgtgccgcctacgtactggccgatgccaacgagcgtcgcgagctg
atcagcaaacgcactgaagagctggcgacgatgcaggaaggtactgccatcgttccccca
gccttgctcgacgaagtgaccgcgctggtcgaatggccggtgccgctggtatgctcgttc
gaggaacgtttcctcgacgtgccacaagaagccctgatcaccaccatgcaggacaaccag
aagtacttctgcctgctggatgccgacggcaagttgctgccacgtttcatcaccgtggcc
aacatcgaaagcaaagacccgcaacagatcatcgccggtaacgagaaagtggttcgtcca
cgcctgaccgacgccgagttcttcttcaagcaagacaagaagcagaaactcgaagacttc
aacctgcgcctgcagaacgtggtgttccaggaaaaactcggcagcgtctacgacaaggcc
gagcgcgtttccaaactggccgcgttcatcgcgcaacgcattggcggcaacgcagcctgg
gcttcccgtgccggcctgctgtccaagtgcgacctggcgaccgagatggtcggtgagttc
ccggagatgcaaggcgtcgccggttactactacgccctcaacgatggcgagccggaagaa
gtcgcactggccctgaatgagcagtacatgccgcgcggtgccggtgctgaactgccgacc
accctgaccggtgcggccgtggccatcgccgacaagctcgataccctggtcggtatcttc
ggcatcggcatgctgccaaccggcagcaaagacccgtacgccctgcgtcgtgcagcactc
ggcgtgttgcgcatcctgatcgacaagaaactcgacctcgacctgaacgacgccgtggca
ttcgccgtgaatgcgttcggtaccaaggtcaaggctgccggcctgaacgattcggtgctg
gagttcatcttcgaccgtctgcgtgcccgttacgaagacgaaggcgtggatgtcgggact
tacctgtcggtccgtgccctgaaaccgggttctgccctggacttcgatcagcgcgtacaa
gccgtggaagcgttccgcaaattgccggaagccgcagccctggccgcagtgaacaaacgc
gtttcgaacttgctgagcaaggtcgaaggctccattccttcggtcgtggaagccaagtat
ttcgacaacgccaacgagttctccctgtactcggcgatccagcaggctgaccaggctgta
cagccgatggccgctgcccgtcagtacagcgaatcgctggcccgtctggctgccttgcgc
gagccggtggatgcgttcttcgaggccgtgatggtcaacgctgaagacgccaaggtccgc
gccaaccgttacgcattgctggcgcgtctgcgtggactgttcctcggcgttgccgacatt
tcgatgctgggctga

DBGET integrated database retrieval system