KEGG   Pseudomonas mandelii: OU5_3860Help
Entry
OU5_3860          CDS       T03626                                 

Definition
(GenBank) glutathione synthetase
  KO
K01920  glutathione synthase [EC:6.3.2.3]
Organism
pman  Pseudomonas mandelii
Pathway
pman00270  Cysteine and methionine metabolism
pman00480  Glutathione metabolism
pman01100  Metabolic pathways
Module
pman_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:pman00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    OU5_3860
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    OU5_3860
Enzymes [BR:pman01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     OU5_3860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSH-S_ATP GSH-S_N RimK ATPgrasp_YheCD
Motif
Other DBs
NCBI-ProteinID: AHZ70939
UniProt: A0A024EDC2
Position
complement(4342218..4343189)
Genome map
AA seq 323 aa AA seqDB search
MSVRVGIVMDPIASISYKKDSSLAMLLAAQKRGWELFYMEQSDLYQAEGEARARMRPLKV
FANPEKWFELEAETDALLSDLDVILMRKDPPFDMEFVYSTYLLEQAERAGVLVVNKPQSL
RDCNEKLFATLFPQCTPPTIVSRRPDVLREFADHHGDVILKPLDGMGGSSIFRHTVGHPN
LSVILETLTLHGKQQIMIQGYLPAIIDGDKRILMIDGEPVDYCLARIPAAGETRGNLAAG
GRGEARPLTDKDRWIAAQVGPTLREKGLLFVGLDVIGEHLTEINVTSPTCIREIDNAFGT
DIGGMLMDAIEKQLQASSRKPQA
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgagcgttcgcgtcgggattgtcatggaccctattgccagcatctcctataaaaaggat
agctcgctggccatgctgctggccgcacagaagcgcggctgggaactgttctatatggaa
cagagcgatttgtaccaggccgaaggtgaagcccgagcgcggatgcgtccgctgaaagtc
ttcgccaacccggaaaaatggttcgaactggaagccgagaccgacgcgctgctgagcgat
cttgacgtgatcctgatgcgcaaggatccgccattcgacatggagttcgtctactccacg
tacctgctggagcaagccgagcgcgctggcgtgctggtggtcaacaagccgcaaagcctg
cgtgactgcaacgaaaagctgttcgccacgctgttcccgcagtgcacgccgccgaccatc
gtcagccgtcgcccggacgtgctgcgcgagttcgccgatcaccacggcgatgtgatcctc
aagccgctggacggcatgggcggttcgtcgatcttccgtcacaccgtcggccacccgaac
ctgtcggtgatcctcgaaaccctgaccttgcatggcaagcagcagatcatgatccagggt
tacttgccggcaatcatcgatggcgacaaacgcatcctgatgatcgacggcgaaccggtg
gattactgcctggcacggatcccggccgccggtgaaacccgtggcaacctggcggccggc
ggtcgtggcgaagctcgcccattgaccgacaaggatcgctggatcgctgctcaggtcggc
ccgaccctgcgtgagaaaggcctgctgttcgtgggtctggacgtgattggtgagcacctc
accgaaatcaacgtcaccagcccgacctgcattcgcgagattgataatgcgtttggcact
gacatcggcggcatgctgatggatgccatagagaagcagctgcaagcttcaagccgcaag
ccgcaagcttga

DBGET integrated database retrieval system