KEGG   Pseudomonas mandelii: OU5_3967Help
Entry
OU5_3967          CDS       T03626                                 

Definition
(GenBank) L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
pman  Pseudomonas mandelii
Pathway
pman00260  Glycine, serine and threonine metabolism
pman01100  Metabolic pathways
pman01110  Biosynthesis of secondary metabolites
pman01120  Microbial metabolism in diverse environments
pman01130  Biosynthesis of antibiotics
pman01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pman00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    OU5_3967
Enzymes [BR:pman01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     OU5_3967
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AHZ71046
UniProt: A0A024EEK0
Position
complement(4460757..4461797)
Genome map
AA seq 346 aa AA seqDB search
MTDKSQQFASDNYSGICPEAWAAMEQANHGHQRAYGDDEWTARASDDFRKLFETDCEVFF
AFNGTAANSLALSSLCQSYHSVICSETAHVETDECGAPEFFSNGSKLLIARTENGKLTPE
SIREVALKRQDIHYPKPRVVTLTQATEVGSVYTPEEIRAISATCKELGLNLHMDGARFSN
ACAFLGCSPADLTWKAGVDVLCFGGTKNGMAVGEAILFFNHKLAEDFDYRCKQAGQLASK
MRFLSAPWVGILENDAWLKYARHANHCAQLLAELVSDIPGVELMFPVQANGVFLQLSEPA
IAALTAKGWRFYTFIGNGGARFMCSWDTEEERVRELAADIREVMSH
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaccgataagagccaacaattcgccagcgacaactattccggtatctgccctgaagcc
tgggctgccatggaacaggccaaccacggccaccaacgcgcttacggcgacgatgaatgg
accgcacgcgcgtccgatgatttccgcaaactgttcgaaaccgactgcgaagtgtttttc
gccttcaacggcaccgcggccaactcgctggccctgtcgtcgctgtgccagagttaccac
agcgtgatctgctcggaaaccgcccacgtcgaaaccgacgagtgcggcgcgccggaattc
ttctccaacggttccaagttgctcattgcccgcaccgaaaacggcaagctgaccccggaa
tcgatccgcgaagtcgccctcaagcgccaggacatccactacccgaaaccccgcgtcgtg
accctgacccaggccaccgaagtcggcagcgtctacaccccggaagaaatccgcgccatc
agcgccacctgcaaagagctgggcctgaacctgcacatggacggcgcgcgcttctccaac
gcctgcgcattcctcggctgctccccggccgacctgacctggaaagccggcgtcgatgtg
ttgtgcttcggcggcacgaaaaacggcatggcggtgggtgaagcgattctgttcttcaac
cacaaactggccgaagacttcgactaccgctgcaaacaggcggggcaactggcctcgaaa
atgcgtttcctgtcggcaccgtgggtcgggattctggaaaacgacgcctggctcaaatac
gcccgccacgccaaccattgcgcgcagcttcttgcagaactggtcagcgatattcccggc
gtggaactgatgttcccggtacaggccaacggcgtgttcctgcaactgtcggagccggcc
atcgctgcactgacggccaagggctggcgtttctacaccttcatcggcaacggcggcgca
cgcttcatgtgctcgtgggataccgaggaagagcgcgtacgtgaattggcggcggatatt
cgcgaagtcatgtcccactaa

DBGET integrated database retrieval system