KEGG   Pseudomonas mandelii: OU5_5009Help
Entry
OU5_5009          CDS       T03626                                 

Definition
(GenBank) threonine aldolase, low-specificity
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
pman  Pseudomonas mandelii
Pathway
pman00260  Glycine, serine and threonine metabolism
pman01100  Metabolic pathways
pman01110  Biosynthesis of secondary metabolites
pman01120  Microbial metabolism in diverse environments
pman01130  Biosynthesis of antibiotics
pman01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pman00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    OU5_5009
Enzymes [BR:pman01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     OU5_5009
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 DUF4031 Cys_Met_Meta_PP Arylesterase ASL_C
Motif
Other DBs
NCBI-ProteinID: AHZ72088
UniProt: A0A024EIA4
Position
5556460..5557464
Genome map
AA seq 334 aa AA seqDB search
MSVIDLRSDTVTQPTAGMLDAMASAPTGDDVYGEDPTVNRLEAELAKRLGFAAALFVPTG
TMSNLLGLMAHCERGDEYIVGQQAHTYKYEGGGAAVLGSIQPQPLEVQADGSLDLAHVVA
AIKPDDFHFARTRLLALENTMQGKVLPLEYLARARSLTREHGLQLHLDGARLYNAAVKLG
VDAREITQHFDSVSVCLSKGLGAPIGSVLCGSAELIGKARRLRKMVGGGMRQAGLLAAAG
LYALDNNVQRLADDHANAQFLADGLQKAGYEVEPVQTNMVYVNMGDKAEAIKAFAAERGI
KLSAAGRLRMVTHMDVDRAQIEQVVATFVEFSRN
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgagcgttatcgatcttcgcagcgacaccgttacccaaccgaccgccggaatgctcgac
gcgatggccagtgcgcccaccggtgacgacgtctatggcgaagatccgacggtcaaccgc
ctggaagcggaactggcaaaacggttggggtttgccgctgcgttgttcgtgccgacgggc
accatgagcaatctgctgggcctgatggctcattgcgaacggggtgacgaatacatcgtc
ggccagcaggcgcacacgtataagtacgaaggtggcggcgcggcggtgcttggctcgatc
cagccgcagccgctggaagtgcaggctgacggctcgttggacctggcgcacgtcgtcgcc
gcgatcaaaccggacgacttccatttcgctcgtacacggttgctggcgctggaaaacacc
atgcagggcaaagtcctgccgctggaatatctcgcccgggcacgcagtcttacccgtgaa
catgggttgcagctgcacctggacggcgctcggctttacaacgcggccgtcaagttgggt
gttgatgcccgcgagatcacccagcacttcgattcggtttcggtctgcctgtccaaaggc
ctgggcgcgccgatcgggtcggtgttgtgcggttcggcagagttgatcggcaaggcgcgt
cgcctgcgcaagatggtcggtggtggcatgcgccaggccggtcttttggccgcggcgggg
ctttatgcgctggataacaacgttcagcgtctggccgacgatcacgccaatgcgcaattt
ctggccgacggactgcaaaaggccggttacgaagtcgagccggtgcagaccaacatggtt
tacgtgaacatgggcgacaaggccgaggcgatcaaggcctttgccgccgagcgtggcatc
aagctgagcgctgccggacgcctgcggatggtcacgcacatggacgttgaccgcgctcaa
atcgagcaggtcgtcgcgacattcgtcgagttttctcgcaactga

DBGET integrated database retrieval system