KEGG   Planococcus maritimus: B0X71_00185Help
Entry
B0X71_00185       CDS       T04763                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
pmar  Planococcus maritimus
Pathway
pmar00450  Selenocompound metabolism
pmar00970  Aminoacyl-tRNA biosynthesis
pmar01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmar00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    B0X71_00185
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    B0X71_00185
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pmar01007]
    B0X71_00185
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pmar03016]
    B0X71_00185
Enzymes [BR:pmar01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     B0X71_00185
Amino acid related enzymes [BR:pmar01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   B0X71_00185
Transfer RNA biogenesis [BR:pmar03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    B0X71_00185
 Prokaryotic type
   Other AARSs
    B0X71_00185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f Zn-ribbon_8 zinc-ribbons_6 Zn_Tnp_IS91
Motif
Other DBs
NCBI-ProteinID: AQQ51707
UniProt: A0A1Q2KV79
Position
39902..41872
Genome map
AA seq 656 aa AA seqDB search
MSEQRKTFYITTPIYYPSGKFHIGTAYTTVASDVIARYKRLRGFDVRFLTGMDEHGQKIE
EKAQEAGKEPQVYVNEIAEAAKQVWATMDITYDDFIQTTEKRHTASVEKIFQRFLDNGDI
YKGEYEGWYCTPCESFFTESQLDEHQHCPDCGRPVHKVKEESYFFNMKKYADRLLKFYED
NPHFIEPESRKNEMVNNFIKPGLEDLSVSRTSFDWGIPVPGDPKHVIYVWVDALSNYITA
LGYGSEDESLFHKYWPADVHVVGKDIVRFHTIYWPIFLMALDLPLPKKVFAHGFIMMKDG
KMSKSKGNVIYPETLVERYGLDATRYFLLRELPFGSDGVFSPEAFVERTNFDLANDLGNL
LNRTISMVNKYFDGTIPQVAGTVTAFDESLQKMAADTIASYEKHMEKMQFSIVLSELWSF
ISRTNKYIDETQPWALAKDETNRDQLASVMAHLAESLRFAAVMLQPFMPHAPKKIIEQLG
LAEELLKWETLNEFGGIPEGINVVQKGTPIFPRLEVEPEVAYIREQMKGSAPKEEEAEVP
AETPEAPETDEITIDEFAKVDLRVATVTDCEPVPKTSKLLKLQVNLGYEQRQVISGIAEH
YQPDDLIGKKVIVVTNLKPVKLRGELSEGMILAGEGSGSLNVVTVNDHLPNGTQIK
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgagcaacgcaagacattttatataacaactccgatttactatccgagcggtaaa
ttccatatcggtacagcttatacaacagttgcttctgacgtaattgcccgttataaacgg
ttgcgcggattcgatgtgcgttttctgaccgggatggacgagcacggccagaaaattgag
gaaaaagcacaggaagcaggaaaagaaccgcaagtatatgtgaatgaaattgcggaagcc
gcaaagcaagtatgggcaacgatggatatcacctatgatgactttatccagacaacagaa
aaacggcatacggcttccgtcgagaagattttccagcgattcttagataatggtgatatt
tacaaaggtgaatatgagggctggtactgtacaccgtgtgaatcgttttttacagaaagc
cagttggatgagcaccagcactgcccggactgcgggcgccccgtccataaagtcaaagag
gaatcctatttctttaatatgaagaaatatgcagatcgcctgctgaagttctatgaagac
aatccgcatttcattgagccggaatcccggaaaaatgagatggtcaataatttcataaag
ccgggccttgaggatctatcggtctcccgcacatcgttcgactggggaattccggtgccg
ggtgatccaaaacacgtcatttatgtctgggtggatgcgctgtcgaactacattacggcg
cttggatacggctcagaagatgaatccctgttccataagtattggccggcggacgtacac
gttgtcgggaaggatattgtgcgtttccatacgatttattggccgatcttcctgatggcg
cttgatctgccgcttccaaagaaagtatttgcccatgggttcatcatgatgaaagacggt
aaaatgtccaaatcaaaggggaatgtcatttatccggaaactcttgtggaacggtatgga
ttggacgcgacacgttatttccttctgcgtgaacttccattcggttcggacggtgtgttt
tcaccggaagcatttgttgaacgcacgaatttcgaccttgcaaacgatttgggtaacctg
ctgaaccggacgatttccatggtcaataagtattttgatggaacgattccgcaagtggca
ggaactgtaactgcttttgacgaaagccttcaaaaaatggcggcagatacaattgcttct
tacgagaagcatatggaaaaaatgcagttcagtattgtcctgagtgaattatggtcattt
atttcacggaccaataagtatattgatgagacacagccatgggcgctggcgaaagatgaa
acaaaccgggatcagcttgcttctgtcatggctcatctggccgagagcctgcgctttgcc
gcagttatgctgcaaccgtttatgccacatgcgccgaaaaaaatcattgaacagcttggc
cttgcggaagagctgctaaaatgggaaacactcaatgagttcggcgggattccggaaggg
ataaatgtggttcaaaaaggaacaccgattttcccgcgcctcgaagtggaaccggaagtt
gcgtatatccgggagcagatgaaaggatcggcgccgaaagaggaagaagctgaagtgccg
gcggaaacgccggaagcacctgagacggatgaaatcacaatcgatgaatttgcgaaagtg
gatttgcgcgtggcaacagtaacggattgcgaacctgttcctaaaacatccaaactgctg
aaactgcaggtgaatttgggatacgaacagcggcaggttatatccggtatcgctgagcat
tatcagccggatgacttgatcggcaagaaagtgatcgttgtgaccaacctgaaaccagtc
aaactcagaggagaactgtcagagggaatgatccttgcaggcgaaggcagcggatcgctt
aatgtcgtgacggttaatgatcatttgccgaatggcacgcagatcaagtaa

DBGET integrated database retrieval system