KEGG   Planococcus maritimus: B0X71_08290Help
Entry
B0X71_08290       CDS       T04763                                 

Definition
(GenBank) 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase
  KO
K05822  tetrahydrodipicolinate N-acetyltransferase [EC:2.3.1.89]
Organism
pmar  Planococcus maritimus
Pathway
pmar00300  Lysine biosynthesis
pmar01100  Metabolic pathways
pmar01110  Biosynthesis of secondary metabolites
pmar01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pmar00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    B0X71_08290
Enzymes [BR:pmar01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.89  tetrahydrodipicolinate N-acetyltransferase
     B0X71_08290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DapH_N Hexapep Hexapep_2
Motif
Other DBs
NCBI-ProteinID: AQQ53092
UniProt: A0A1Q2KZM5
Position
complement(1630883..1631602)
Genome map
AA seq 239 aa AA seqDB search
MVKEFTAQEIIQYISDSDKKTPLKIYVNTEFVKSDFPSSFQVFGNEGSFTIFADLKDWKP
FYEANEAQLQDLVIEQDRRNSAIPLLDATNINARIEPGAFIREHAVIGDSAVIMMGATIN
IGAVVGEGTMIDMNAVLGGRATTGKNVHVGAGAVLAGVIEPPSAKPVIIEDNVLIGANAV
VLEGVTVGEGAVVAAGSIVTEDVPAGAVVAGVPARVIKQASEVQGGKIEIVQALRKLNQ
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
ttggtaaaagaatttacagcacaggaaatcattcagtacatcagtgattcagacaagaaa
accccattgaaaatatacgtaaacaccgaatttgtgaaatccgacttcccttcaagcttc
caggtattcggcaacgaggggtccttcacgatctttgcggatttgaaagactggaagccg
ttctatgaagccaatgaagcacagctgcaggatctggtcattgaacaagaccgccgcaac
agtgccatcccgcttctcgatgcgacaaacatcaacgcacggatcgagccgggtgcattc
atccgggaacatgccgttatcggcgacagtgccgtcatcatgatgggcgcgacaatcaat
attggcgcagtggtcggtgaaggtacgatgatcgatatgaacgcggtcctcggcggccgc
gctacgacaggcaaaaacgtccatgtcggcgcaggtgccgtgcttgcaggcgtcattgaa
ccgccaagcgcaaaaccggttatcattgaagataacgtcctgatcggtgccaacgcagtc
gttcttgaaggcgtaacagtcggtgaaggcgcagttgtcgcagcaggctcgatcgtgaca
gaagatgtgccggccggcgcagttgtggcaggcgttccagcccgtgtcattaaacaggcg
agtgaagtgcagggcgggaaaattgaaatcgtccaggccctcagaaaactgaatcagtaa

DBGET integrated database retrieval system