KEGG   Planococcus maritimus: B0X71_09595Help
Entry
B0X71_09595       CDS       T04763                                 

Definition
(GenBank) arginine--tRNA ligase
  KO
K01887  arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
pmar  Planococcus maritimus
Pathway
pmar00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:pmar00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    B0X71_09595
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pmar01007]
    B0X71_09595
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pmar03016]
    B0X71_09595
   03029 Mitochondrial biogenesis [BR:pmar03029]
    B0X71_09595
Enzymes [BR:pmar01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     B0X71_09595
Amino acid related enzymes [BR:pmar01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   B0X71_09595
Transfer RNA biogenesis [BR:pmar03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    B0X71_09595
 Prokaryotic type
   Other AARSs
    B0X71_09595
Mitochondrial biogenesis [BR:pmar03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    B0X71_09595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1d DALR_1 Arg_tRNA_synt_N AvrM-A DUF1107 tRNA-synt_1g
Motif
Other DBs
NCBI-ProteinID: AQQ55073
UniProt: A0A1Q2L3S6
Position
1863904..1865595
Genome map
AA seq 563 aa AA seqDB search
MDITKPFAAAIAAQLDHQLTIEEIGALLEKPKFEAQGDLAFPCFTLAKKFRKSPAAVAAD
IASGIQDSSLAKVVADGPYVNGFLNRSTVSQHVLTTILETGASYGSSSAGADRSITLDLS
SPNIAKPFSMGHLRSTVIGNALANIAEKHGYQTVRINHLGDWGTQFGKLIAAYKKWGKDE
QIEANPIKELLKLYVKFHEEAKTDPALEIEGRLWFKRLEDGDGEAQRLWTWFREESLQEF
NKIYELLDVRFDSVHGEAFYNDKMDEVVELLKEKKLLQESEGAEVVDLSDHDLPPLLIRK
SDGATLYGTRDAAAALYRQRQYHFAESLYVVGQEQSLHFKQLFLTLQKMGYEWAQHMHHI
PFGFILKNGKKMSTRKGEIVLLEEVIREAIELAGQNIREKNPSLPNPAEVAHQVGVGAII
FHDLKNDRQSNIEFSLEHMLRFEGATGPYVQYTHARACSILRKAEIYNAQLTPNGLDDDA
SWPVIKLLLAFPEVINRSFKEYEPSVIAKFVLELAQAFNAFYGKVKVLSEDREQETRLAL
VQAVVIVLNEGLRLLGVKAPMEM
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atggacatcaccaaaccgtttgcagcagctattgctgcccaattggatcatcagctgacg
atcgaagaaattggcgcattacttgaaaaaccgaaattcgaagcacagggagatcttgcg
tttccgtgctttacgctggcaaagaagttccgaaaatcacccgctgcagttgcggcggac
attgcctcaggcatccaggactcatctcttgcgaaagtcgtcgcggatgggccctatgtg
aatggctttttgaaccgcagcactgtcagccagcatgttcttacaaccattttggaaaca
ggtgcgtcttacggttcttcatcggccggtgcagaccggtcgatcacactcgatctatca
tccccgaatatcgccaaaccattttccatgggccatctccggtcgacggtcatcggtaac
gcactcgccaatattgcggaaaaacacgggtatcagacggtgcgcattaatcatctcggc
gattggggaacgcaattcggaaagctcatcgcggcttataaaaaatggggcaaagatgaa
caaatcgaagcaaacccgatcaaggaattgctgaaactatatgtgaagttccatgaagaa
gcaaaaacagatccggcgcttgaaatcgaaggccggctatggttcaagcggctagaagat
ggagacggggaagcgcagcggctctggacgtggttccgggaagagtcgctccaggaattc
aataaaatctatgaattgctggatgttcggtttgattccgtccacggagaagcattctac
aatgataaaatggacgaagttgtagaactgctgaaggaaaagaaattgctgcaagaatca
gagggagcggaagtggtcgatttgagtgatcacgacctgcccccgcttctcatccgcaaa
tcggatggcgccacgctgtatggtacccgcgatgcggcagccgcactttaccggcagcgg
cagtatcatttcgccgaatccctgtatgtcgtcggccaggaacaatcattgcatttcaag
cagttgtttttgacccttcagaaaatgggctatgagtgggcacagcatatgcaccacatt
ccattcggcttcatcttgaaaaacggcaagaagatgtcgacccggaaaggggaaatcgtc
ctcctggaagaagtgatccgggaagcgatcgaacttgcaggccagaatatccgggagaaa
aatccctcgctgccaaatccagcagaagttgcgcatcaagtcggtgtcggcgccatcatt
ttccatgacttgaaaaatgaccggcaaagcaatatcgagttttcccttgaacatatgctg
cgatttgaaggtgcaacgggtccttatgttcagtacacgcatgcgcgggcctgctccatt
ctccggaaagcggaaatatataatgcgcagctcacaccgaatggactcgatgatgacgcc
agctggccggtcatcaaattgctgctggcatttccggaggtaatcaaccgcagcttcaag
gaatacgagccatcggtcattgccaagttcgtcttggaactcgcacaggcgttcaatgct
ttttacggcaaagtcaaagtcctgtcagaagaccgggaacaagaaacacgcctcgccctc
gtgcaagctgtggtaattgtattgaacgaaggattgcggctgcttggcgtaaaagcgccc
atggagatgtag

DBGET integrated database retrieval system