KEGG   Planococcus maritimus: B0X71_11660Help
Entry
B0X71_11660       CDS       T04763                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pmar  Planococcus maritimus
Pathway
pmar00071  Fatty acid degradation
pmar00072  Synthesis and degradation of ketone bodies
pmar00280  Valine, leucine and isoleucine degradation
pmar00310  Lysine degradation
pmar00362  Benzoate degradation
pmar00380  Tryptophan metabolism
pmar00620  Pyruvate metabolism
pmar00630  Glyoxylate and dicarboxylate metabolism
pmar00640  Propanoate metabolism
pmar00650  Butanoate metabolism
pmar00900  Terpenoid backbone biosynthesis
pmar01100  Metabolic pathways
pmar01110  Biosynthesis of secondary metabolites
pmar01120  Microbial metabolism in diverse environments
pmar01130  Biosynthesis of antibiotics
pmar01200  Carbon metabolism
pmar01212  Fatty acid metabolism
pmar02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pmar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    B0X71_11660
   00630 Glyoxylate and dicarboxylate metabolism
    B0X71_11660
   00640 Propanoate metabolism
    B0X71_11660
   00650 Butanoate metabolism
    B0X71_11660
  09103 Lipid metabolism
   00071 Fatty acid degradation
    B0X71_11660
   00072 Synthesis and degradation of ketone bodies
    B0X71_11660
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    B0X71_11660
   00310 Lysine degradation
    B0X71_11660
   00380 Tryptophan metabolism
    B0X71_11660
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    B0X71_11660
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    B0X71_11660
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    B0X71_11660
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pmar04147]
    B0X71_11660
Enzymes [BR:pmar01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     B0X71_11660
Exosome [BR:pmar04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   B0X71_11660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Ketoacyl-synt_C ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AQQ53669
UniProt: A0A1Q2KZQ1
Position
complement(2251231..2252415)
Genome map
AA seq 394 aa AA seqDB search
MSNEVVIVSAVRTATGSFLGALKDVSASELGAVAIKAAIERAGIAADQVDEVIMGNVLQA
GLGQNPARQAALKAGLPETVSAMTINKVCGSGLKAVHLATQAIIAGDADVIVAGGMENMS
QAPYILPKAREGFRMGNQEVVDTMLSEGLTCAFNDYHMGVTAENLNDRYGISREEQDAFA
ARSQERAAAAIDAGKFKDEIVPVEIPQRKGDPVVFDTDEYPRRGTTAESLGKLRPAFKKE
GSVTAGNASGINDGAAAVVVMSKAKAEELGLTPLATVIANGSAGVDPAVMGIGPVEAVRK
ALKKADLELKDIDLIEANEAFAAQSIAVDRELKMNHDIMNVNGGAIALGHPIGASGARIF
VTLLHEMRKRDAKIGLATLCIGGGQGVATVVKRP
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaatgaagtggttattgtaagcgctgtcagaacggcgacgggttcattccttggc
gcgctgaaagatgtatcggcttctgaactgggcgctgtggccatcaaggcagccatcgag
cgggccggcattgcggcggatcaggtggatgaggtcattatgggcaacgtgctgcaggcg
gggctcggacaaaatccggcgaggcaggcggcgttgaaagcagggctgccggagacggtt
tcggcgatgacgatcaataaagtatgcggatccggcttgaaagccgtacacttggcgacg
caggcaatcatcgcaggggatgcggatgtgattgtggcaggcggcatggaaaatatgagc
caggcgccgtatatcctgccaaaagcccgggaaggattccggatgggtaatcaggaagtt
gtcgacacgatgctgtcggaagggctgacttgtgctttcaacgattaccacatgggtgtg
acagctgagaatctgaacgaccgctatggtatctcgcgtgaagaacaggacgcattcgca
gcgcgttcccaggaacgggcggcggcagccattgatgccggcaaattcaaggatgaaatc
gtgccggtggaaattccgcagcgtaaaggagatcctgtcgtattcgataccgatgaatat
ccgcggcgcggcactactgccgaatcgctcggcaaattgcggccggcgttcaaaaaagag
ggcagtgtcacagcgggcaacgcgtccggcatcaatgacggtgcggcagcagttgtcgtt
atgtcaaaagcgaaagcggaagaactgggactgacaccgcttgcaacagtcattgccaac
ggcagtgcaggcgtggacccggctgtcatgggaatcggcccggttgaagcggtgcgcaaa
gcgctgaagaaagcagacctcgaattgaaagatatcgacctcattgaagcgaatgaagca
ttcgcggcccagtcgattgcagttgatcgcgaactaaagatgaatcatgatattatgaat
gtcaacggcggcgccattgcgcttggtcacccgatcggtgcaagcggagcgcgcattttc
gtgacacttctgcacgaaatgcggaaacgggatgcgaaaatcggccttgccacattatgt
atcggcggtggccaaggcgtggcaaccgttgtaaaacgcccgtaa

DBGET integrated database retrieval system