KEGG   Prochlorococcus marinus AS9601: A9601_01781Help
Entry
A9601_01781       CDS       T00464                                 

Gene name
ndhA
Definition
(GenBank) putative respiratory-chain NADH dehydrogenase subunit
  KO
K05572  NAD(P)H-quinone oxidoreductase subunit 1 [EC:7.1.1.2]
Organism
pmb  Prochlorococcus marinus AS9601
Pathway
pmb00190  Oxidative phosphorylation
pmb01100  Metabolic pathways
Module
pmb_M00145  NAD(P)H:quinone oxidoreductase, chloroplasts and cyanobacteria
Brite
KEGG Orthology (KO) [BR:pmb00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    A9601_01781 (ndhA)
Enzymes [BR:pmb01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     A9601_01781 (ndhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NADHdh YbgT_YccB
Motif
Other DBs
NCBI-ProteinID: ABM69466
CYORF: A9601_01781
UniProt: A2BNV5
Position
complement(164936..166054)
Genome map
AA seq 372 aa AA seqDB search
MEYGLDLEYSFNEFLKGFGLSSEIAHIIWLPLPMLLVLVAAVVGVLVTVWLERKISAAAQ
QRIGPEYAGALGVLQPIADGLKLLVKEDIIPAKADGILFTAGPILVLVPVILSWLIVPFG
QNLLISNVGIGIFLWIALSSIQPIGLLMSGYASNNKYSLLGGLRAAAQSISYEIPLALSV
LAIVLMTNSLSTIDIVNQQSGAGILSWNIWRQPVGFIVFWICALAECERLPFDLPEAEEE
LVAGYQTEYAGMKFALFYLGSYINLILSALLVSILYLGGWGFPVPVELIAKFLNLPINAP
FLQVFTASIGIVMTVLKAYLLVFIAILLRWTTPRVRIDQLLDLGWKFLLPISLANLLITA
GLKLAFPQFFGG
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
ttggaatacggattagatctcgaatatagttttaatgaatttttaaaaggctttggcctt
tccagcgaaatcgcccatataatttggctccctctgccaatgcttttggttttggtagcg
gcagtagttggtgttttagtaacagtttggcttgaaagaaaaatatctgctgctgctcag
caaagaataggtcctgaatatgcaggagcacttggcgtactccaaccaattgcagatggg
cttaagttacttgttaaagaggatattattcctgctaaagcggatggaattctctttact
gcaggacctatattagtacttgtcccagtgattctatcctggttaattgttccttttgga
caaaatcttttaataagtaatgttggtattggaattttcctatggattgctttaagcagt
atccagccaataggacttctcatgagcggatatgcatcaaataataagtattctttatta
ggaggtttaagagcagcagctcaatcaattagttatgaaattcctctagctttatctgta
ctagctattgtactaatgacaaattctctaagtactattgacattgtcaaccaacaaagt
ggtgctggaatcttaagttggaatatatggagacaaccagttggttttatagtcttttgg
atttgtgctcttgcagaatgtgagagacttccatttgacttacccgaagctgaagaagaa
ttagttgcaggatatcaaactgaatatgcagggatgaaattcgcattgttctacctaggt
agttacattaatctaatcctttcagctttattggtatcaatactttatttgggaggatgg
ggttttcctgttccagttgaattaatagctaagtttctaaacttgcccattaatgcaccc
tttttacaagtgttcactgcatcaataggaattgtaatgactgtattgaaagcatatctt
ttagttttcattgcaatattattgcgttggacaactcctagagtaagaatagatcaacta
ttagaccttggatggaagtttcttcttccaatttctcttgctaatcttttgataactgca
ggattaaaacttgcttttccgcaattctttggtggttaa

DBGET integrated database retrieval system