KEGG   Prochlorococcus marinus AS9601: A9601_11741Help
Entry
A9601_11741       CDS       T00464                                 

Gene name
folD
Definition
(GenBank) putative bifunctional Methylenetetrahydrofolate dehydrogenase Methenyltetrahydrofolate/cyclohydrolase
  KO
K01491  methylenetetrahydrofolate dehydrogenase (NADP+) / methenyltetrahydrofolate cyclohydrolase [EC:1.5.1.5 3.5.4.9]
Organism
pmb  Prochlorococcus marinus AS9601
Pathway
pmb00670  One carbon pool by folate
pmb01100  Metabolic pathways
pmb01120  Microbial metabolism in diverse environments
pmb01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pmb00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    A9601_11741 (folD)
Enzymes [BR:pmb01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.5  methylenetetrahydrofolate dehydrogenase (NADP+)
     A9601_11741 (folD)
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.9  methenyltetrahydrofolate cyclohydrolase
     A9601_11741 (folD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: THF_DHG_CYH_C THF_DHG_CYH AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: ABM70458
CYORF: A9601_11741
UniProt: A2BRP7
Position
989255..990151
Genome map
AA seq 298 aa AA seqDB search
MSLKLDGKKLSLEIEKRLNDYISNNKIIAKRVPGLAVIRIGEDPASGVYVNNKEKACSRI
GIKSFIFHLDESVEQKEVEQLIIKLNSDKDIDGMLLQLPIPKKFDEQKLISHINPSKDVD
GLNEINIGKLVKNEPGMRSCTPAGIINLLRSQNITIEGKKIVVIGRSLLVGKPLSLMLLN
LNGTVTMTHSKTLNLNKVCREADILIAAAGKPNLIDSSFVKEGAVIIDVGIHRLKSSDKN
QTRLCGDVLLEDVISKVFAYTPVPGGVGPMTVTMLLVNTIFSWQKQFGLSSTLNDLLP
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgtcattaaaattagacggtaaaaaattatctcttgaaattgaaaaaagattaaatgac
tacatttctaataataaaataattgcaaaaagagtgcccggtttagctgtaataagaata
ggtgaagaccctgcgagtggtgtttacgttaataacaaggaaaaggcatgttcaaggatt
ggaataaagagctttatctttcatttagatgaaagtgtagagcaaaaagaagttgaacaa
ttaataatcaaactgaattcggataaggatattgatggaatgttgctacaacttcccatc
ccaaagaagtttgatgagcaaaaactgatcagccatattaatccaagcaaagatgtagat
ggattaaatgagataaacatcggtaaattagtaaaaaatgagcctgggatgagatcatgt
acacccgcaggaattattaatttattaagatcccaaaatattacaattgaaggtaagaaa
attgttgttattggaagaagtttgcttgttgggaaacctctatcgcttatgttattgaat
ctaaatggcactgtaacaatgacccattcaaaaacattaaatttgaataaagtctgtaga
gaagccgacatattaattgcggctgcaggaaaacccaatcttatagattcgagttttgtt
aaagaaggagccgtaattattgatgttggaatacatagattaaaaagttccgataaaaat
caaaccagattatgtggagatgtattattagaagatgtcatttctaaagtatttgcttac
acacctgtaccaggaggtgttggaccaatgacagtaacaatgttacttgtaaatactatt
tttagctggcaaaaacaatttggtttatcatcaactcttaatgaccttttgccataa

DBGET integrated database retrieval system