KEGG   Prochlorococcus marinus AS9601: A9601_14621Help
Entry
A9601_14621       CDS       T00464                                 

Gene name
argF
Definition
(GenBank) Ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
pmb  Prochlorococcus marinus AS9601
Pathway
pmb00220  Arginine biosynthesis
pmb01100  Metabolic pathways
pmb01110  Biosynthesis of secondary metabolites
pmb01130  Biosynthesis of antibiotics
pmb01230  Biosynthesis of amino acids
Module
pmb_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:pmb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    A9601_14621 (argF)
Enzymes [BR:pmb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     A9601_14621 (argF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N PALP
Motif
Other DBs
NCBI-ProteinID: ABM70745
CYORF: A9601_14621
UniProt: A2BSI4
Position
complement(1246475..1247401)
Genome map
AA seq 308 aa AA seqDB search
MLNPIKLASKNFLSSLDTSLEEFLHILELAKNFKNKDLSIKLQEKVLGLIFDKSSTRTRV
SFQVAMSRLGGTTVDLNPTTSQIGRGEPIRDTARVLSRYCDVLAIRTFKQTDLEEYAKWS
SKPIINALTDLEHPCQALADFMTIKEEFLDFNDVVLTFIGDGNNVANSLILCGALLGVEV
RIACPKGYEPNSLLIDKAYEIYENKNLLKITNEPNTAVLGANVLYTDVWSSMGEENQKDE
KEKVFNGFTIDRDLVSKADKDAIILHCLPAYRSKEITDEIFESHKSRIFDQAENRLHAQQ
ALLSCILQ
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgttaaatccgatcaagcttgcaagtaaaaatttcttatcaagcttggatacttcactt
gaagaatttcttcatattttagagttagccaaaaattttaaaaataaagatctaagtata
aaactccaagaaaaagttttagggttaatttttgataagtcatcaactcgcaccagagtt
agcttccaagtggcaatgtcaagacttggtggcaccacagttgacctaaatcctactact
tcacaaattgggaggggagagccaatcagagatacagcaagagtgctaagtagatactgc
gatgttcttgcgataagaacgtttaaacaaactgatttggaagagtacgcaaaatggtcc
tctaaaccaattattaatgctcttactgatttagaacatccatgtcaggcactagctgat
tttatgacaattaaagaggaatttcttgattttaacgatgtagttttgacatttattgga
gacggtaataacgtcgcaaattctcttattttatgtggcgcgttattaggagtagaagtt
aggattgcatgccctaaaggttatgaacctaactcgttgttaattgataaagcatatgaa
atatatgaaaataagaatttgttgaaaatcactaatgaacccaacaccgctgttttagga
gcaaatgttctttatacagatgtttggtcatctatgggtgaagaaaatcaaaaagatgag
aaagaaaaagtttttaatggttttactattgacagagatttagttagtaaggccgataaa
gatgcaattattcttcattgccttcctgcctatagatccaaagagataactgatgaaata
tttgaaagtcacaaaagtagaatttttgatcaagcggaaaatagattacatgctcaacaa
gctcttttatcttgcattctccaatag

DBGET integrated database retrieval system