KEGG   Prochlorococcus marinus AS9601: A9601_14961Help
Entry
A9601_14961       CDS       T00464                                 

Gene name
trpC
Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
pmb  Prochlorococcus marinus AS9601
Pathway
pmb00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pmb01100  Metabolic pathways
pmb01110  Biosynthesis of secondary metabolites
pmb01130  Biosynthesis of antibiotics
pmb01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pmb00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    A9601_14961 (trpC)
Enzymes [BR:pmb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     A9601_14961 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS NanE
Motif
Other DBs
NCBI-ProteinID: ABM70779
CYORF: A9601_14961
UniProt: A2BSL8
Position
complement(1277266..1278153)
Genome map
AA seq 295 aa AA seqDB search
MEIRRRPPNPTVRVENLEYAVPHREAQAKNILEEIVWHKDIEIKNFKKIVSLEDLIKKIE
NLPTPKDFYKNILESKIKPGVIAEIKKASPSKGVIRKDFNPENIAICYEGLGASCISVLT
DKKFFQGSYEILETVRKSTNLPLLCKDFIISAYQIYKARVSGADAILLIAAILSDDDLIY
LKKIADNLKMSVLVEVHNSYELERILKLKSFNLIGINNRDLKTFKTDLKTSKELMNTYAD
IFLKQNIIPISESGINCAEDLESLRSIGIMGVLIGETFMRETDIEQSFKKLFNSI
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atggagataagacgcaggccaccaaatccaacagtgagggtagaaaacttagaatatgct
gtacctcatagagaagcacaagcaaaaaacattctggaagaaattgtatggcacaaggat
attgaaattaagaattttaaaaaaatagtctctttagaagatctcatcaaaaaaattgaa
aatcttcctactcccaaagatttttataaaaatatcttggagtcaaaaataaaaccagga
gttattgctgaaataaaaaaagctagtccgagtaaaggagttattagaaaagattttaac
cctgaaaacatagcaatttgttatgaaggattaggtgcatcatgtatctcagtacttacc
gataaaaagttttttcaaggtagttatgaaatactcgaaactgtaaggaaatctactaat
ctccctctactctgcaaagattttattatttctgcttatcagatttataaagcaagggta
tctggtgctgatgcaatattattaatcgctgcgattttaagtgatgatgatttaatttat
ttaaagaaaatagctgataatttaaagatgagtgttcttgttgaagtccataactcttat
gaattagaaaggattctaaagttaaaatcttttaatttgattggaataaataatagggac
ttaaagacttttaaaacggatttaaaaacatcaaaagaattgatgaatacatatgcagat
atatttttaaaacaaaatattattcccataagtgaatctggaattaattgtgccgaagat
ttagaatcgcttagatctattggaatcatgggagtattaattggtgaaacttttatgaga
gaaactgatattgaacaatcgttcaagaaattatttaactcaatttaa

DBGET integrated database retrieval system