KEGG   Prochlorococcus marinus AS9601: A9601_17601Help
Entry
A9601_17601       CDS       T00464                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
pmb  Prochlorococcus marinus AS9601
Pathway
pmb03010  Ribosome
Brite
KEGG Orthology (KO) [BR:pmb00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    A9601_17601 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:pmb03011]
    A9601_17601 (rplV)
Ribosome [BR:pmb03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    A9601_17601 (rplV)
  Bacteria
    A9601_17601 (rplV)
  Archaea
    A9601_17601 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ABM71043
CYORF: A9601_17601
UniProt: A2BTD2
Position
complement(1495348..1495734)
Genome map
AA seq 128 aa AA seqDB search
MTKTPETTKKAIAHGNYVRGSASKVRRVLDQIRGRSYRDALIMLEFMPYRSTDPITKVLR
SAVANAEHNLGMDPSTLVISSAWANSGPVMKRYRPRAQGRAFSIKKQTCHISISVESAPT
ETNAEVQN
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaacacctgaaacaacaaaaaaagcaattgctcatgggaattacgttcgcgga
tcggcctctaaagtgagaagagttttggatcagataaggggtaggtcttatagagatgca
ttgattatgttggaatttatgccttacagatctacagaccccataactaaagttctaaga
tctgctgttgccaatgcagaacataaccttggaatggatccatccaccttagttatttct
tctgcatgggctaatagtggtccagtaatgaaaaggtataggcccagagctcaaggtcga
gctttttcaattaaaaaacagacttgccacatcagcatttctgttgaatcggctcctact
gaaactaatgcggaggtacaaaactaa

DBGET integrated database retrieval system