KEGG   Prochlorococcus marinus MIT 9515: P9515_05311
Entry
P9515_05311       CDS       T00465                                 
Symbol
gmk
Name
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
pmc  Prochlorococcus marinus MIT 9515
Pathway
pmc00230  Purine metabolism
pmc01100  Metabolic pathways
pmc01232  Nucleotide metabolism
Module
pmc_M00050  Guanine ribonucleotide biosynthesis, IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:pmc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    P9515_05311 (gmk)
Enzymes [BR:pmc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     P9515_05311 (gmk)
SSDB
Motif
Pfam: Guanylate_kin AAA_18 AAA_33 AAA_16 Rad17 AAA_22 RsgA_GTPase NTPase_1 MMR_HSR1 AAA_14 Ploopntkinase2 ABC_tran AAA_29 T2SSE AAA CPT
Other DBs
NCBI-ProteinID: ABM71740
CyanoBase: P9515_05311
UniProt: A2BVC9
Position
475049..475603
AA seq 184 aa
MKNLKKLIIITGPSGVGKGTVVKQLLDSKKDIWLSISATTRNPRMGEKDGVNYYFISDEK
FKDMVDKKEFLEWAQFAGNYYGTPLSTVNEKIESGFIVLLEIEVEGAKQIKEKFPEALSI
FLLPPSDEELEKRIRNRGTEKEEAIKMRLRRAKYEIASSDRFDFVLTNYHVDETVKRIFE
IIKS
NT seq 555 nt   +upstreamnt  +downstreamnt
atgaaaaatttaaaaaaactcattattatcacaggcccaagtggagttgggaaaggtact
gttgttaaacaacttttagatagtaaaaaagatatatggctttctatctctgcgacaaca
agaaaccccagaatgggagagaaagatggtgtgaattattactttattagtgatgaaaag
tttaaagatatggtcgataaaaaagaatttcttgaatgggctcaattcgcaggtaattat
tatggaactccactatctactgtaaatgaaaagattgaaagtggatttattgttttactg
gaaattgaagttgaaggtgccaaacaaattaaagaaaagttcccagaagctttatcaata
tttcttcttcctcctagcgatgaggaattagaaaaaagaataagaaatagaggtactgaa
aaagaagaggcaataaaaatgagacttaggagagctaaatacgaaattgcttcctcagat
agatttgattttgttttaacaaattatcatgttgatgagacagttaaaagaattttcgaa
ataattaagtcttga

DBGET integrated database retrieval system