KEGG   Prochlorococcus marinus MIT 9515: P9515_00531Help
Entry
P9515_00531       CDS       T00465                                 

Gene name
ndk
Definition
(GenBank) Nucleoside diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
pmc  Prochlorococcus marinus MIT 9515
Pathway
pmc00230  Purine metabolism
pmc00240  Pyrimidine metabolism
pmc01100  Metabolic pathways
pmc01110  Biosynthesis of secondary metabolites
Module
pmc_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
pmc_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
pmc_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:pmc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    P9515_00531 (ndk)
   00240 Pyrimidine metabolism
    P9515_00531 (ndk)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pmc04131]
    P9515_00531 (ndk)
Enzymes [BR:pmc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     P9515_00531 (ndk)
Membrane trafficking [BR:pmc04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    P9515_00531 (ndk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK PSI_PsaJ
Motif
Other DBs
NCBI-ProteinID: ABM71262
CyanoBase: P9515_00531
CYORF: P9515_00531
UniProt: A2BU01
Position
58628..59086
Genome map
AA seq 152 aa AA seqDB search
MIKERTFLAIKPDGVQRGYIAEIIGRFEKKGFKLVGLKQLIPSKQLAQDHYGVHRERPFF
KDLVNFISSGPVVAMIWEGEGVILSARKIIGATKPLEAEPGTIRGDLAIDIGRNIIHGSD
GEETAKFEINLWFDQHEICDWETSDSEWRVES
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaagagagaacgtttcttgcaattaaaccagatggtgttcaaagaggatatatt
gctgagattattggaaggtttgaaaaaaaaggctttaaattggtaggcttaaaacaatta
attccatcaaagcaacttgctcaagatcactatggggttcatagagagagaccttttttt
aaggatttagttaactttatttcgagtggccctgttgttgcgatgatttgggaaggagag
ggagtaattctaagtgcaagaaaaataattggtgcgacaaaacctcttgaggcggaacct
ggaactattagaggggatttagctatagatatagggagaaacataattcatggttcagat
ggagaagaaactgctaaatttgaaattaatttatggtttgatcaacatgaaatatgtgat
tgggagacttcagattctgaatggcgagtagaaagttaa

DBGET integrated database retrieval system