KEGG   Prochlorococcus marinus MIT 9515: P9515_08371Help
Entry
P9515_08371       CDS       T00465                                 

Gene name
pcyA
Definition
(GenBank) ferredoxin-dependent biliverdin reductase
  KO
K05371  phycocyanobilin:ferredoxin oxidoreductase [EC:1.3.7.5]
Organism
pmc  Prochlorococcus marinus MIT 9515
Pathway
pmc00860  Porphyrin and chlorophyll metabolism
pmc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pmc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    P9515_08371 (pcyA)
Enzymes [BR:pmc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.5  phycocyanobilin:ferredoxin oxidoreductase
     P9515_08371 (pcyA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe_bilin_red
Motif
Other DBs
NCBI-ProteinID: ABM72044
CyanoBase: P9515_08371
CYORF: P9515_08371
UniProt: A2BW83
Position
complement(758133..758858)
Genome map
AA seq 241 aa AA seqDB search
MLSESLTKTKLIDPLILTLLQNIRGHRSNLENLKSIKIDPKLSNIISDKEGKELYIENEF
HKAKGFRKLHIEVAEFSRRLKILHCVFFPDPHYDIPIFGMDLVKVNEVVSAAIVDLSPSS
KNQNLKYDNLLSTIDKSVFESEREIPGWGDIFSQNVFFASLKNESEKSAFCKIVDHYLLV
LIKLSKSSILDHDQEIIQERIDFQKNYCRQQMKNEKTSLVLLKYFDKKWVDEYIKKVLFD
F
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
ttgttgtctgaatctttaactaaaaccaaattaattgatccacttattttgactttattg
caaaatattagaggacataggtctaatctagaaaaccttaaatccattaagatagaccct
aagctttcaaatataatttcggataaggaaggtaaagaactatatattgaaaatgaattc
cataaggcaaaaggatttagaaaattacatatcgaagtagctgaattttctaggcgtctt
aagattttacattgtgtattcttccctgacccacattatgatattccaatatttggtatg
gatttagtcaaagtaaatgaagtggtttctgccgctattgttgatttatccccttcttca
aagaatcaaaatttaaaatacgataacttgttgtctacgattgataaaagtgtatttgaa
tcagagagggagatcccaggatggggagatatcttctctcaaaatgtattttttgcttct
ttaaaaaatgagagtgaaaaaagtgctttttgtaaaattgttgatcactacctattagta
ttaataaaattaagtaaaagttctatacttgatcatgatcaagaaataattcaagaaaga
atcgattttcaaaaaaattattgtagacaacaaatgaaaaatgaaaaaacaagtttggtt
ctactgaagtatttcgacaaaaaatgggtagatgaatatatcaaaaaagtactatttgat
ttttga

DBGET integrated database retrieval system