KEGG   Prochlorococcus marinus MIT 9515: P9515_09041Help
Entry
P9515_09041       CDS       T00465                                 

Gene name
tpi
Definition
(GenBank) Triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pmc  Prochlorococcus marinus MIT 9515
Pathway
pmc00010  Glycolysis / Gluconeogenesis
pmc00051  Fructose and mannose metabolism
pmc00562  Inositol phosphate metabolism
pmc00710  Carbon fixation in photosynthetic organisms
pmc01100  Metabolic pathways
pmc01110  Biosynthesis of secondary metabolites
pmc01120  Microbial metabolism in diverse environments
pmc01130  Biosynthesis of antibiotics
pmc01200  Carbon metabolism
pmc01230  Biosynthesis of amino acids
Module
pmc_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pmc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    P9515_09041 (tpi)
   00051 Fructose and mannose metabolism
    P9515_09041 (tpi)
   00562 Inositol phosphate metabolism
    P9515_09041 (tpi)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    P9515_09041 (tpi)
Enzymes [BR:pmc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     P9515_09041 (tpi)
Exosome [BR:pmc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   P9515_09041 (tpi)
  Exosomal proteins of bladder cancer cells
   P9515_09041 (tpi)
  Exosomal proteins of melanoma cells
   P9515_09041 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABM72111
CyanoBase: P9515_09041
CYORF: P9515_09041
UniProt: A2BWF0
Position
804917..805642
Genome map
AA seq 241 aa AA seqDB search
MRKSVIAGNWKMHMTCAETKNYLEEFIPLIKDLPNDRKIVIAPPFTAISTFSSYSNFDYL
DIASQNIHWEDQGAFTAEISPKMLIEHNVKYAIVGHSEPRKYFSESDEQINKRAVFAQSS
GLTPIVCVGETLEQRERGEANRVITRQVEQGLENTDPSNLIIAYEPIWAIGTGKTCEASD
ANKICALIRELIGFDDVIIQYGGSVKPNNIDEIMSMSDINGVLVGGSSLDPISFSRIANY
E
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
ttgagaaaatctgtaatcgccggtaattggaagatgcacatgacttgtgctgaaacaaaa
aattatttggaggaatttattcctcttataaaagaccttcctaatgataggaagattgtt
attgcccctccatttacagcaatttcaactttttcgagttactctaactttgattattta
gatattgcaagccaaaacattcactgggaagatcaaggtgctttcacagcagaaatttct
ccaaaaatgcttattgaacacaatgttaaatatgcaattgttggacatagtgaacctagg
aaatatttcagtgaaagtgatgaacaaattaataagagagcagtatttgctcaatcaagt
ggtctcactccaatagtctgtgttggtgaaactcttgaacaaagagaaagaggagaagct
aatagagtcatcacaagacaagttgaacaaggattggagaatactgatccatctaatctc
ataattgcttatgaacctatatgggcgattggtaccggtaaaacttgtgaagcaagtgat
gccaataaaatatgtgctttgataagggagttaataggttttgatgatgtaattattcaa
tatggaggttctgttaagcctaataatattgacgagattatgtcgatgagcgatattaat
ggagtattggtagggggctcttctctagatccaattagtttttcaagaattgcaaattac
gaataa

DBGET integrated database retrieval system