KEGG   Prochlorococcus marinus MIT 9515: P9515_14111Help
Entry
P9515_14111       CDS       T00465                                 

Gene name
rfbC
Definition
(GenBank) dTDP-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
pmc  Prochlorococcus marinus MIT 9515
Pathway
pmc00521  Streptomycin biosynthesis
pmc00523  Polyketide sugar unit biosynthesis
pmc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pmc00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    P9515_14111 (rfbC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    P9515_14111 (rfbC)
Enzymes [BR:pmc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     P9515_14111 (rfbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom DUF5037
Motif
Other DBs
NCBI-ProteinID: ABM72618
CyanoBase: P9515_14111
CYORF: P9515_14111
UniProt: A2BXV7
Position
1250283..1250840
Genome map
AA seq 185 aa AA seqDB search
MKISETPIAGAYILENDVYRDNRGSFTCFYIEDDFKKNNLNTKWTQINSSLSFDERTLRG
IHFQYPPYSQIKLVRVIQGSIFDVIVDLRPKSKTFGKHFFYFLNEKNNKMLYIANGFGHG
FMTMENNTKIIYNVSAPYKPEYEETIIWNDKLLNIQWPNSPLKLSAKDLNGKTFNEIKLE
ILNRV
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
ttgaagatctcagaaacacccatagctggagcatatattctggaaaacgatgtttataga
gataatagaggttcttttacttgtttttatattgaggatgattttaaaaaaaataatttg
aatactaaatggacacaaataaatagctcactaagttttgatgaaagaacattaagaggt
atacattttcagtatcccccctattcccaaataaaactagttagggtaatccaaggatct
atttttgatgtaatcgtagatttaaggccgaaatcaaaaacttttggtaaacacttcttt
tattttttaaatgaaaaaaataataagatgctttatattgcgaatggttttggacatgga
ttcatgacaatggaaaataatacaaagattatctacaacgtatctgcaccctataaacca
gagtatgaagaaacaataatatggaatgataaattattaaatattcaatggccaaattct
ccattaaaattatctgccaaagacttgaatggtaaaacatttaatgaaatcaaactagag
attttaaatagagtatga

DBGET integrated database retrieval system