KEGG   Prochlorococcus marinus MIT 9515: P9515_19071Help
Entry
P9515_19071       CDS       T00465                                 

Gene name
thrC
Definition
(GenBank) Threonine synthase: Pyridoxal-5'-phosphate-dependent enzymes, beta family
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
pmc  Prochlorococcus marinus MIT 9515
Pathway
pmc00260  Glycine, serine and threonine metabolism
pmc00750  Vitamin B6 metabolism
pmc01100  Metabolic pathways
pmc01110  Biosynthesis of secondary metabolites
pmc01120  Microbial metabolism in diverse environments
pmc01230  Biosynthesis of amino acids
Module
pmc_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pmc00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    P9515_19071 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    P9515_19071 (thrC)
Enzymes [BR:pmc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     P9515_19071 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Phage_TAC_12 ATP13
Motif
Other DBs
NCBI-ProteinID: ABM73114
CyanoBase: P9515_19071
CYORF: P9515_19071
UniProt: A2BZA3
Position
1702901..1704004
Genome map
AA seq 367 aa AA seqDB search
MKFINKIKNKFKGNYRKKRWPGLINAYRQYLPVSSKTPIISLNEGNTPLIFSESISNLLG
NNTKVYLKYDGLNPTGSFKDRGMTMAISKAKEEGREAVICASTGNTSAAAAAYASRGGLR
SYVIIPDGYVAQGKLAQALMYGAEIISIQGNFDKALEIVRDLSSEYPINLVNSVNPYRIQ
GQKTAAFEIVDDLGIAPDWLCIPMGNAGNITAYWLGFKEYRKIKKNLKLPIMMGFQSEGS
APLVKNIIVKDPETIATAIRIGNPVNRDKAKIVKKESKGDFQSVTDKEIIEAYKMLAKEG
VFCEPASAASVAGLIKNKNRIKKGSTIVCVLTGNGLKDPDCAINNNDAVFRKNIEPSLKN
ITKVLGY
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcataaataaaattaaaaataaattcaaaggaaattacagaaaaaaaagatgg
ccagggttaattaatgcatatagacaatatctgccagtatcttcaaaaactcccattatt
tccttaaatgaaggaaatactcctcttatattcagtgaatcaattagtaatctacttgga
aacaatacaaaagtttatttaaaatatgacggcttaaatcctactggatcattcaaagac
agaggaatgacaatggctataagtaaagcaaaagaagaagggcgtgaagctgtaatatgc
gctagtacaggaaacacttctgctgctgctgctgcttatgcttcaagaggtggtttaaga
tcttatgtaataattcctgatggatacgtagctcagggaaaacttgctcaagctttaatg
tatggtgcagaaattatttctatacaaggtaattttgataaagctttggaaatagttaga
gacttatcttctgaatatccaataaaccttgtaaattctgttaatccttatcgaatacaa
ggtcaaaagactgctgcctttgagatagtagatgacttaggtattgctcctgactggctt
tgtatacctatgggaaatgcaggaaacataacggcttattggttagggttcaaagagtat
agaaaaataaaaaagaatttaaaattaccaattatgatgggatttcaatctgaaggatct
gcacctttggtaaaaaatattatcgttaaagatcctgaaaccattgcaacagcaattaga
attggaaatcctgtaaatagagacaaagcaaaaatagtcaaaaaagaaagcaaaggagat
tttcagtctgttactgataaagaaattattgaagcttataaaatgcttgccaaagaagga
gttttttgtgaaccagcaagcgctgcctctgttgcagggcttattaaaaataaaaacaga
ataaaaaaaggatcaacaatagtttgtgttttaacaggaaatgggttaaaagatccagat
tgtgccattaataataatgacgctgttttcagaaaaaatattgaaccttcattaaaaaat
ataactaaagttttaggatactaa

DBGET integrated database retrieval system