KEGG   Prochlorococcus marinus NATL1A: NATL1_02431Help
Entry
NATL1_02431       CDS       T00467                                 

Gene name
chlM
Definition
(GenBank) Mg-protoporphyrin IX methyltransferase
  KO
K03428  magnesium-protoporphyrin O-methyltransferase [EC:2.1.1.11]
Organism
pme  Prochlorococcus marinus NATL1A
Pathway
pme00860  Porphyrin and chlorophyll metabolism
pme01100  Metabolic pathways
pme01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pme00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    NATL1_02431 (chlM)
Enzymes [BR:pme01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.11  magnesium protoporphyrin IX methyltransferase
     NATL1_02431 (chlM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg-por_mtran_C Methyltransf_25 Methyltransf_12 Methyltransf_31 Methyltransf_11 Methyltransf_23 MTS PrmA Ubie_methyltran Methyltransf_18 CMAS Methyltransf_32 Methyltransf_4 AdoMet_MTase GidB
Motif
Other DBs
NCBI-ProteinID: ABM74807
CyanoBase: NATL1_02431
CYORF: NATL1_02431
UniProt: A2BZZ7
Position
224307..225008
Genome map
AA seq 233 aa AA seqDB search
MTTQIEKNEKAEVTEYFNGTGFDRWNRIYSESDDVNKVQKNIRIGHQKTVDDVISWLKEY
DNIKDKSFCDAGCGVGSLSIPLAKLGAKSIHLSDISEAMINETKSRAKEEGLDFNKLNFR
TSDLENLKGSFNTVVCLDVFIHYPQQKAEAMVKHLCELSDERLIVSFAPYTPLLALLKGI
GQLFPGPSKTTRAYTLRESGIIEAAKQSGFKVVKSKLNQAPFYFSKLIEFVKS
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgacaacgcaaattgagaaaaatgaaaaggcggaagtcactgaatattttaatgggact
gggtttgatagatggaatcgaatatatagcgaaagtgatgatgtaaataaagtgcaaaaa
aatataaggataggtcaccaaaagacagttgatgatgtcattagttggttgaaagagtat
gacaatatcaaggataaaagtttttgtgatgctggctgtggtgttggtagtttaagtatt
ccattggcaaaattgggtgctaaatcaattcatttaagtgatatttctgaagccatgata
aacgagacaaaaagtagggcaaaggaagaaggtttggacttcaataagctgaattttcga
acatctgatttagaaaatttaaaaggttcatttaatacagttgtttgcttagatgttttc
attcactaccctcaacagaaggctgaggcaatggtgaaacatctatgtgaattatctgat
gagagattaattgttagctttgcaccatacactcctttactagcccttttgaaaggtatt
ggtcagctattccctggaccaagtaaaactactagggcatatacattaagggagtccgga
attatcgaagctgcaaagcaatctggctttaaagttgtcaaaagcaagttgaatcaagct
cctttttatttttcgaaattaatagaatttgtgaaatcctag

DBGET integrated database retrieval system