KEGG   Prochlorococcus marinus NATL1A: NATL1_03121Help
Entry
NATL1_03121       CDS       T00467                                 

Gene name
pyrB
Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
pme  Prochlorococcus marinus NATL1A
Pathway
pme00240  Pyrimidine metabolism
pme00250  Alanine, aspartate and glutamate metabolism
pme01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pme00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    NATL1_03121 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NATL1_03121 (pyrB)
Enzymes [BR:pme01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     NATL1_03121 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace DUF4431
Motif
Other DBs
NCBI-ProteinID: ABM74876
CyanoBase: NATL1_03121
CYORF: NATL1_03121
UniProt: A2C066
Position
complement(289712..290731)
Genome map
AA seq 339 aa AA seqDB search
MNNWKHNHVLDLSTFSLEDYKTVLELTTRFKDVHKSSSKKLPALHGRLIANLFFEPSTRT
RTSFELAAKRLSADVQNFSVSSSSLSKGETPLDTILTYISMGADILVIRHESTNVPAELA
NYVDINNINTSILNAGDGFHSHPSQGLLDLFTLATFFNPNEPSTNSLLNKKITIVGDILH
SRVARSNLWALTACGAEVTLCGPPSLLPEEFIDFVQNPRLGQNFDPINKRGSVFIKRSLK
DALKNSDAVMTLRLQKERMKQNMLKDLDSYYAQYGITHESLKWCEKKVPVLHPGPVNRGV
EISNRLVEDNSINLISKQVENGIPTRMALLYLLGLNKKD
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaataattggaaacataatcacgttcttgatttatctacgttttctttagaggattac
aaaacagttttagaattaacaacaagatttaaagatgtccataaatcaagttctaagaaa
cttcccgctcttcatggaagattaattgccaacttatttttcgagccaagtacaaggaca
agaactagctttgagcttgcagcaaagagactatctgcggatgttcagaatttttctgta
tcttcaagttctctaagcaaaggagagactcctttagacactattctcacatacatctca
atgggggctgatatcttagtaattaggcatgagtcaacaaatgtacccgcagagttagct
aattacgttgacataaataacatcaatacatccattctcaatgcaggtgatggatttcat
agccatccaagtcaaggtcttttggatctattcacacttgctactttttttaatccaaat
gaaccatcaactaatagtcttttaaataaaaaaattacaatagttggagatattcttcat
tctagagttgccagatcaaacctttgggctctaactgcatgtggagcagaggtaacacta
tgtggacctccaagccttcttccagaagaattcattgattttgttcagaatcctcggcta
gggcaaaattttgatcccattaataagagaggttctgttttcataaaaagatcgctaaaa
gacgcattaaaaaatagtgatgctgttatgacacttcgattacagaaagagagaatgaag
caaaatatgcttaaggatcttgatagttattatgcacaatatgggataacccatgaaagt
ttaaaatggtgtgaaaagaaagttcctgtccttcatcctggaccagtaaatagaggggta
gaaataagtaaccgattagttgaagataattcaatcaatcttataagtaaacaagtagaa
aatggtattccaacaagaatggctttgttgtatttactagggttaaataaaaaagattaa

DBGET integrated database retrieval system