KEGG   Prochlorococcus marinus NATL1A: NATL1_04561Help
Entry
NATL1_04561       CDS       T00467                                 

Gene name
pdhC
Definition
(GenBank) Dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pme  Prochlorococcus marinus NATL1A
Pathway
pme00010  Glycolysis / Gluconeogenesis
pme00020  Citrate cycle (TCA cycle)
pme00620  Pyruvate metabolism
pme01100  Metabolic pathways
pme01110  Biosynthesis of secondary metabolites
pme01120  Microbial metabolism in diverse environments
pme01130  Biosynthesis of antibiotics
pme01200  Carbon metabolism
Module
pme_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pme00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NATL1_04561 (pdhC)
   00020 Citrate cycle (TCA cycle)
    NATL1_04561 (pdhC)
   00620 Pyruvate metabolism
    NATL1_04561 (pdhC)
Enzymes [BR:pme01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     NATL1_04561 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-ProteinID: ABM75020
CyanoBase: NATL1_04561
CYORF: NATL1_04561
UniProt: A2C0L0
Position
417220..418590
Genome map
AA seq 456 aa AA seqDB search
MATHDIFMPALSSTMTEGKIVEWLKKPGDKVERGESVLVVESDKADMDVESFQDGFLASI
VMPAGSSAPVGETIGLIVETEDEIAAAQANSPSPSPQSGSQEKDSSSPQVQEKQASVDSP
KATVVTKASPAPLVSESSVNQDQFLNDGRIVASPRAKKLASQMGVDLATVRGSGPHGRIQ
AEDVQSAKGQPISVPWIAESNAPAKIVSDVPRVEKKSVDAGKPPAPGKSFGSRGETIAFN
TLQQAVNRNMEESLNTPCFRVGYSILTDELDDLYKQVKPDGVTMTALLAKAVGLTLARHP
QVNAAFSSEGIAYPSQINVAVAVAMEDGGLITPVLQNADKTSLTDLSLQWADLVKRARNK
QLEPQEYSSGTFTLSNLGMFGVDRFDAILPPGTGAILAVGASLSKVVASKDGSISIKKQM
QVNLTADHRVIYGADGALFLKDLAYLIEKNPYSLSS
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atggccactcatgacatttttatgcctgctttaagttcaacgatgactgagggcaaaata
gttgagtggctaaaaaaacctggagataaagttgaaagaggtgagtcagttttagttgtt
gagtcagataaagctgatatggatgttgagtctttccaagatggctttcttgcttcgatt
gtgatgcctgcaggcagctctgcacctgttggagagacaatcggattgatcgttgagaca
gaagatgagatcgctgcggctcaagcaaattcgccttctccttcccctcaatcaggaagt
caagaaaaagatagttcatcgcctcaagttcaagaaaaacaagcctctgtcgactctcct
aaagcaacagtagttacaaaggcatctcctgcacctcttgtttcagaatcctctgtaaat
caggatcagtttttaaatgatggtcgaatagtcgcttccccaagagctaaaaaacttgct
tctcaaatgggagtggatttggcaactgttaggggctcaggacctcatggacgaatacaa
gctgaggatgttcaaagtgcaaaagggcaacccataagcgttccttggattgcagaaagt
aatgctccggcgaaaatagtttctgatgtgcctcgcgtagaaaaaaaatctgttgacgct
ggtaagccacctgctccagggaaaagttttggatctagaggggaaacaattgcatttaat
actcttcaacaagctgtaaatcggaacatggaggaaagtttaaatactccttgtttcaga
gtcggatattcaattcttactgatgaattggatgatctttataaacaagttaaacctgat
ggagtaactatgactgctttacttgctaaagcagttggcttaacgctggctagacacccc
caggtgaatgcagcttttagttctgaggggattgcctatccttcacaaataaatgtagcc
gttgcagttgcgatggaggacggagggttgataactccagtgctgcaaaatgctgataag
acgagccttactgatttatccctacaatgggctgatcttgttaagcgagctaggaataag
caattagaaccgcaagaatatagcagtggaacgtttacactctcgaatctaggtatgttt
ggagtggatcgttttgatgcaattctgcccccagggactggagcaattttagcggtagga
gcttcattgtctaaagttgttgcttctaaagatggttcgatttcaatcaaaaaacaaatg
caagtaaatcttaccgctgatcacagagtgatatatggggctgatggagcactattcctc
aaggatttggcatacttaattgaaaagaacccttatagcctctcgtcttga

DBGET integrated database retrieval system