KEGG   Prochlorococcus marinus NATL1A: NATL1_06271Help
Entry
NATL1_06271       CDS       T00467                                 

Gene name
trpA
Definition
(GenBank) Tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pme  Prochlorococcus marinus NATL1A
Pathway
pme00260  Glycine, serine and threonine metabolism
pme00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pme01100  Metabolic pathways
pme01110  Biosynthesis of secondary metabolites
pme01130  Biosynthesis of antibiotics
pme01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pme00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NATL1_06271 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NATL1_06271 (trpA)
Enzymes [BR:pme01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     NATL1_06271 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth IGPS ThiG NanE
Motif
Other DBs
NCBI-ProteinID: ABM75189
CyanoBase: NATL1_06271
CYORF: NATL1_06271
UniProt: A2C129
Position
570379..571179
Genome map
AA seq 266 aa AA seqDB search
MKSTNISRSFSKIKKEKRIALMPFLMAGDPDLETTAKILLELQANGADMIELGIPYSDPL
ADGPIIQLAASRALSAGTSPDRVFKMLFELRDQLKIPIILFTYSNPLINKGLEEFCWQAS
KVGVSGLVVPDLPLEEAEKLSDIAESKEIDLVLLVAPTTPKDRMKKIAATSNGFTYLVSV
TGVTGERSSLEDNVGSLVQQLKDSSSSPIAVGFGISDVKHIEQVREWGADGAIVGSALVK
RIANASIEMKVEEAGSFCKELRAATN
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaagtacaaatatcagtaggtctttttccaaaataaaaaaggagaaaagaattgca
ctaatgcctttccttatggcaggtgaccctgatttggaaactacagcaaagattttgtta
gagcttcaggcaaatggcgctgacatgattgagctaggcattccatacagtgatccttta
gcagatggtccgattattcaattagcagcttctcgagctctctctgcaggaacctcccct
gacagggtttttaaaatgttgtttgaattgagagatcaattgaaaataccaataatttta
tttacttactcaaacccacttattaataaaggtctggaagaattttgctggcaagcatcg
aaagtaggtgtttcaggacttgtcgtaccagatcttcctctagaggaagcagaaaaactt
tctgatattgctgaatctaaggaaattgatttggttttacttgttgctcctacaacccca
aaggatcgtatgaaaaaaatcgcagcgacttctaatggattcacttatcttgtaagtgtt
actggggtaactggagaaaggtcatcattagaagataatgtaggatctcttgtgcaacaa
ctaaaagattcttcatctagtccaattgctgtgggctttggaatttcggatgtaaaacac
attgaacaagttagagaatggggcgctgatggcgcaattgttggtagtgctttagttaaa
agaattgctaatgcctcgatcgaaatgaaagtcgaagaagctggttctttttgtaaagaa
ctaagagccgcaactaattaa

DBGET integrated database retrieval system